powered by:
Protein Alignment CG12780 and XTH12
DIOPT Version :9
Sequence 1: | NP_610388.1 |
Gene: | CG12780 / 35834 |
FlyBaseID: | FBgn0033301 |
Length: | 100 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_200561.1 |
Gene: | XTH12 / 835857 |
AraportID: | AT5G57530 |
Length: | 285 |
Species: | Arabidopsis thaliana |
Alignment Length: | 54 |
Identity: | 14/54 - (25%) |
Similarity: | 19/54 - (35%) |
Gaps: | 13/54 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 50 WAADII----GKDKDGRWT-------YTN-RDVELKDGDVLYYWTTVRYNGRDY 91
|.||.. ||.|.. || |.: .||:......::.|.|...|...:
plant 190 WEADDWATQGGKVKTD-WTNAPFSASYRSFNDVDCCSRTSIWNWVTCNANSNSW 242
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2273 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1209387at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.