DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12780 and XTH9

DIOPT Version :9

Sequence 1:NP_610388.1 Gene:CG12780 / 35834 FlyBaseID:FBgn0033301 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_192230.1 Gene:XTH9 / 828024 AraportID:AT4G03210 Length:290 Species:Arabidopsis thaliana


Alignment Length:117 Identity:17/117 - (14%)
Similarity:35/117 - (29%) Gaps:45/117 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QVPLARVTSSERRGFEVSIDDEPGISLFGFHGRLNEPIVDLGNQTWAAD-------IIGKDKDGR 62
            :.|:....:.|.:|...:.|...|:.                :..|.||       ::..|    
plant   161 ETPIRVQKNLEEKGIPFAKDQAMGVY----------------SSIWNADDWATQGGLVKTD---- 205

  Fly    63 WTY------------------TNRDVELKDGDVLYYWTTVRYNGRDYHRMNQ 96
            |::                  |..|:...:||..::|.....:....|:.:|
plant   206 WSHAPFVASYKEFQIDACEIPTTTDLSKCNGDQKFWWDEPTVSELSLHQNHQ 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12780NP_610388.1 CBM39 6..97 CDD:292510 17/116 (15%)
XTH9NP_192230.1 GH16_XET 25..284 CDD:185685 17/117 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1209387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.