powered by:
Protein Alignment CG12780 and XTH21
DIOPT Version :9
Sequence 1: | NP_610388.1 |
Gene: | CG12780 / 35834 |
FlyBaseID: | FBgn0033301 |
Length: | 100 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_179470.1 |
Gene: | XTH21 / 816395 |
AraportID: | AT2G18800 |
Length: | 305 |
Species: | Arabidopsis thaliana |
Alignment Length: | 73 |
Identity: | 17/73 - (23%) |
Similarity: | 24/73 - (32%) |
Gaps: | 30/73 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 GIS-LFGFHGRLNEPIVDLGNQTWAADIIGKDKDGRWTYTNRDVELKDGDVLYYWTTVRYNGRDY 91
|:| |...||:.....:|: ||. |||....|....|..|
plant 16 GLSILLVVHGKDFNQDIDI---TWG--------DGRGNILNNGTLLNLG---------------- 53
Fly 92 HRMNQSAG 99
::||:|
plant 54 --LDQSSG 59
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2273 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1209387at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.