powered by:
Protein Alignment CG12780 and XTH21
DIOPT Version :10
| Sequence 1: | NP_610388.1 |
Gene: | CG12780 / 35834 |
FlyBaseID: | FBgn0033301 |
Length: | 100 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_179470.1 |
Gene: | XTH21 / 816395 |
AraportID: | AT2G18800 |
Length: | 305 |
Species: | Arabidopsis thaliana |
| Alignment Length: | 73 |
Identity: | 17/73 - (23%) |
| Similarity: | 24/73 - (32%) |
Gaps: | 30/73 - (41%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 28 GIS-LFGFHGRLNEPIVDLGNQTWAADIIGKDKDGRWTYTNRDVELKDGDVLYYWTTVRYNGRDY 91
|:| |...||:.....:|: ||. |||....|....|..|
plant 16 GLSILLVVHGKDFNQDIDI---TWG--------DGRGNILNNGTLLNLG---------------- 53
Fly 92 HRMNQSAG 99
::||:|
plant 54 --LDQSSG 59
|
Known Domains:
Indicated by green bases in alignment.
Return to query results.
Submit another query.