DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12780 and XTH21

DIOPT Version :10

Sequence 1:NP_610388.1 Gene:CG12780 / 35834 FlyBaseID:FBgn0033301 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_179470.1 Gene:XTH21 / 816395 AraportID:AT2G18800 Length:305 Species:Arabidopsis thaliana


Alignment Length:73 Identity:17/73 - (23%)
Similarity:24/73 - (32%) Gaps:30/73 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GIS-LFGFHGRLNEPIVDLGNQTWAADIIGKDKDGRWTYTNRDVELKDGDVLYYWTTVRYNGRDY 91
            |:| |...||:.....:|:   ||.        |||....|....|..|                
plant    16 GLSILLVVHGKDFNQDIDI---TWG--------DGRGNILNNGTLLNLG---------------- 53

  Fly    92 HRMNQSAG 99
              ::||:|
plant    54 --LDQSSG 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12780NP_610388.1 CBM39 6..97 CDD:464924 14/69 (20%)
XTH21NP_179470.1 GH16_XET 27..296 CDD:185685 12/62 (19%)

Return to query results.
Submit another query.