DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12780 and GNBP1

DIOPT Version :10

Sequence 1:NP_610388.1 Gene:CG12780 / 35834 FlyBaseID:FBgn0033301 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_524142.2 Gene:GNBP1 / 40034 FlyBaseID:FBgn0040323 Length:492 Species:Drosophila melanogaster


Alignment Length:95 Identity:30/95 - (31%)
Similarity:46/95 - (48%) Gaps:1/95 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SGYQVPLARVTSSERRGFEVSIDDEPGISLFGFHGRLNEPIVDLGNQTWAADIIGKDKDGRWTYT 66
            :.|::|...|...| .||.|||.||.|:.:..|:...|.......|:......:.:.::||||..
  Fly    18 TAYKIPTPTVELLE-TGFSVSIPDEEGVKVVAFNVNRNRNFTSFINEGQYNVRLTEPQNGRWTTN 81

  Fly    67 NRDVELKDGDVLYYWTTVRYNGRDYHRMNQ 96
            ...|.|:..||||.||:|::....|..:.|
  Fly    82 FSSVPLRSQDVLYLWTSVQHQKAVYQDLAQ 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12780NP_610388.1 CBM39 6..97 CDD:464924 29/91 (32%)
GNBP1NP_524142.2 CBM39 21..124 CDD:464924 29/92 (32%)
GH16_beta_GRP 175..491 CDD:185688
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.