DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12780 and GNBP-like3

DIOPT Version :9

Sequence 1:NP_610388.1 Gene:CG12780 / 35834 FlyBaseID:FBgn0033301 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_611483.1 Gene:GNBP-like3 / 37313 FlyBaseID:FBgn0034511 Length:152 Species:Drosophila melanogaster


Alignment Length:93 Identity:57/93 - (61%)
Similarity:71/93 - (76%) Gaps:1/93 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YQVPLARVTSSERRGFEVSIDDEPGISLFGFHGRLNEPIVDLGNQTWAADIIGKDKDGRWTYTNR 68
            |.||.|.|..:..:||||||.||||||||.|||::||.:.||.:||||||:: ..::|||||.||
  Fly    24 YDVPKATVKVNSPKGFEVSIPDEPGISLFAFHGKVNEEMDDLSDQTWAADVV-SSRNGRWTYRNR 87

  Fly    69 DVELKDGDVLYYWTTVRYNGRDYHRMNQ 96
            :.:|:.|||||||||.||:|.|||..||
  Fly    88 NHQLRPGDVLYYWTTARYHGVDYHNYNQ 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12780NP_610388.1 CBM39 6..97 CDD:292510 56/91 (62%)
GNBP-like3NP_611483.1 CBM39 26..121 CDD:292510 56/91 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452116
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105633at50557
OrthoFinder 1 1.000 - - FOG0006727
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.