powered by:
Protein Alignment CG12780 and C08F1.12
DIOPT Version :9
Sequence 1: | NP_610388.1 |
Gene: | CG12780 / 35834 |
FlyBaseID: | FBgn0033301 |
Length: | 100 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001309537.1 |
Gene: | C08F1.12 / 27219612 |
WormBaseID: | WBGene00269389 |
Length: | 104 |
Species: | Caenorhabditis elegans |
Alignment Length: | 33 |
Identity: | 9/33 - (27%) |
Similarity: | 14/33 - (42%) |
Gaps: | 5/33 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 GFHGRLNEPIVDLGNQTWAADIIGKDKDGRWTY 65
||.|: ||| ..:.|:.......:..:|.|
Worm 65 GFSGK--EPI---SGRQWSGVCRWNVETSQWDY 92
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG12780 | NP_610388.1 |
CBM39 |
6..97 |
CDD:292510 |
9/33 (27%) |
C08F1.12 | NP_001309537.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1209387at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.