DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12780 and C08F1.12

DIOPT Version :9

Sequence 1:NP_610388.1 Gene:CG12780 / 35834 FlyBaseID:FBgn0033301 Length:100 Species:Drosophila melanogaster
Sequence 2:NP_001309537.1 Gene:C08F1.12 / 27219612 WormBaseID:WBGene00269389 Length:104 Species:Caenorhabditis elegans


Alignment Length:33 Identity:9/33 - (27%)
Similarity:14/33 - (42%) Gaps:5/33 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 GFHGRLNEPIVDLGNQTWAADIIGKDKDGRWTY 65
            ||.|:  |||   ..:.|:.......:..:|.|
 Worm    65 GFSGK--EPI---SGRQWSGVCRWNVETSQWDY 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12780NP_610388.1 CBM39 6..97 CDD:292510 9/33 (27%)
C08F1.12NP_001309537.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1209387at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.