DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mtt and CG32447

DIOPT Version :9

Sequence 1:NP_001260806.1 Gene:mtt / 35832 FlyBaseID:FBgn0050361 Length:1472 Species:Drosophila melanogaster
Sequence 2:NP_996144.1 Gene:CG32447 / 40412 FlyBaseID:FBgn0052447 Length:658 Species:Drosophila melanogaster


Alignment Length:397 Identity:85/397 - (21%)
Similarity:142/397 - (35%) Gaps:123/397 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   922 IPEIYLRPESAWAIGAMAFSATGILV----TLFVMGVFVRHNDTPIVRASGRE--LSYILLAGIF 980
            :|...||.| .|.:..:..:...:|:    .:||:  |.....:|    |.|.  |..:||.|:|
  Fly   175 LPFAGLRKE-PWVVPVLVLATLTMLMMAAFEIFVL--FKAWRTSP----SRRHLFLGQMLLLGLF 232

  Fly   981 MCYGVTFALVLKPTNIVCAIQRFGVGFCFTVVYAALLTKTNRIARIFKAGKQSAKRPSFISPKSQ 1045
            .|..:...:..:|:.|.|...|||||..:.:|:||||.|.     :|..   |.....::....|
  Fly   233 ACASLGAIITAQPSLISCGAIRFGVGVAYALVFAALLVKC-----VFLI---SLNGGVYLPAPYQ 289

  Fly  1046 LVICACLVSVQILINGVWMVIAP------------------------SHAMHHYPTREDNL---- 1082
            .::....:.:|:.|.|.|::..|                        :::...|||....|    
  Fly   290 GLLLLFALLIQVAIGGQWLLTQPPEVYTTSVPVMGSGFLSTTVASQTNYSALFYPTSYTTLDGTP 354

  Fly  1083 --------------LVCDSYIDASYMIAFSYPIFLIVICTVYAVLTRKIPEAFNESKHIGFTMYT 1133
                          .:|.:.. :..:.:..|.:||||...|.|:.:|.|.:.:.|:.:||..:..
  Fly   355 EIYTRIAAVSTVLIPLCKTQF-SELLFSLIYIVFLIVFIAVLAIKSRGIRDNYREATYIGLAIGG 418

  Fly  1134 TCVIWLAFVPLYFGTANH-----VPLRITSMSVTISLSASVTIACLFSPK-----------LYII 1182
            ...|||.::......|..     |...:.:.|.|:.|       .:|.||           ||: 
  Fly   419 AIPIWLGWMLCGLAVAERHKDACVAFGLVATSATVFL-------VMFMPKGRQLAAMGKEGLYV- 475

  Fly  1183 LIRPERNVRQSMM---------------PPRYG--------NMHRTAGTGPSSMMAA-------- 1216
               .:|..:.|.:               |.:||        |.....|.|.||...:        
  Fly   476 ---EDREEQFSSLSRAGSGYSPSFFHFKPIKYGVMSGCGLPNSASNTGQGLSSKHCSSANNGGDR 537

  Fly  1217 -AVVTAA 1222
             |:||||
  Fly   538 VALVTAA 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mttNP_001260806.1 Periplasmic_Binding_Protein_Type_1 73..>152 CDD:299141
PBP1_mGluR 393..847 CDD:107357
ANF_receptor 422..820 CDD:279440
NCD3G 861..910 CDD:284890
7tm_3 945..1181 CDD:278433 64/299 (21%)
CG32447NP_996144.1 7tm_3 <378..461 CDD:278433 21/89 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.