DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-A8 and amy2al2

DIOPT Version :9

Sequence 1:NP_610384.1 Gene:Mal-A8 / 35830 FlyBaseID:FBgn0033297 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001003729.1 Gene:amy2al2 / 445049 ZFINID:ZDB-GENE-040801-179 Length:512 Species:Danio rerio


Alignment Length:564 Identity:106/564 - (18%)
Similarity:175/564 - (31%) Gaps:199/564 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MELLSLLTLLLLAIASNEACQVQSSSSETTKDWWQTAQFYQIYPRSFKDSDGDGIGDLNGITSKL 65
            |.||.|:.:..|..|.:........:|......|:.|...:...|....:...|:    .|:...
Zfish     1 MMLLVLVAIFGLGFAQHNPNTKNGRTSIVHLFEWRWADIAEECERYLAPNGYGGV----QISPPS 61

  Fly    66 EYLKDLGVTAAW------LSPIFKSPMVDFGYDISDFFDIQPEYGTLEDFRTLIKRAKELDLKIV 124
            |::|   :|..|      ..||              .:::....||..:.:.:|.|...:.:.|.
Zfish    62 EHVK---LTNPWHPWWQRYQPI--------------SYNLCSRSGTEAELKDMITRCNNVGVNIY 109

  Fly   125 LDFVPNH-----------SSNESEWFLKSVKREKGYED-------YYVWHDGKVNSTTGKREPPT 171
            .|.|.||           ||..|.:       :...||       |..::|||..|.:|:.|   
Zfish   110 ADVVINHMCKSIHGAGTPSSCGSHF-------DANKEDFPTVPYSYLDFNDGKCKSASGQIE--- 164

  Fly   172 NWLQYFRGSAWEWNEVRQQYYLHQFAVQQ-PDLNYRNPLVVEQMKRVLRYWLNEGVSGFRCDAL- 234
                       .:|::   |.:....::. .||......|..::...|...:..||:|||.||. 
Zfish   165 -----------SYNDI---YQVRDCRLEDLLDLALEKDYVRGKVAEYLNKLIELGVAGFRVDACK 215

  Fly   235 ---------------------------PPLFEVVPDSDG---------------QFPDEVVSGAT 257
                                       |.:::.|.|..|               :|......|..
Zfish   216 HMWPGDLSNVYSRLKTLNTKWFPSGTKPFIYQEVIDLGGEPIKASEYYGLARVTEFKHSAKIGTA 280

  Fly   258 EDKEDRDYLTTTYIEN-------QPETIDMVYQWRTVLDDHKRIFG---GNSSVLLIETYSPAWF 312
            ..|.|.:.|  :|::|       .|....:|:     :|:|....|   |.:|||       .::
Zfish   281 VRKWDGEKL--SYLKNWGEGWGFMPSDKALVF-----VDNHDNQRGHGAGGASVL-------TFW 331

  Fly   313 TMQFYGNRSTEGAHLPFNFNLITVMEQSGLSASNVQEAIDLWLKNMPAGRTPN-WVLGNHDKRRA 376
            ..:.|  :...|..|...:.:..||       |:.|     |.:.:..|:..| |:         
Zfish   332 DSRLY--KMAAGFMLAHPYGVTRVM-------SSYQ-----WDRKIVNGKDENDWM--------- 373

  Fly   377 ASRYGKENI-DGMNMLVMILPGVSVTYQGEEIGMTDGEISWEDTVDPWGCN------SNPNIYEQ 434
                |..:. ||....|.|.|           ..|.|        |.|.|.      .|..|:..
Zfish   374 ----GPPSFSDGSTKPVPINP-----------DSTCG--------DGWVCEHRWRQIRNMVIFRN 415

  Fly   435 YTRDPERTPFQW--TGGTNAGFTNGSSTWLPLAAD----YATIN 472
            ....  :..|.|  .|.:...|:.||..::.:..|    .||:|
Zfish   416 VVNG--QPLFNWWDNGNSQIAFSRGSKGFIVINNDNWELNATLN 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-A8NP_610384.1 AmyAc_maltase 30..506 CDD:200467 99/535 (19%)
trehalose_treC 33..585 CDD:274115 99/532 (19%)
Malt_amylase_C 487..585 CDD:295440
amy2al2NP_001003729.1 AmyAc_bac_euk_AmyA 25..417 CDD:200456 90/496 (18%)
Aamy_C 424..511 CDD:214749 9/34 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576519
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.