DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-A8 and amy2al1

DIOPT Version :9

Sequence 1:NP_610384.1 Gene:Mal-A8 / 35830 FlyBaseID:FBgn0033297 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_956722.1 Gene:amy2al1 / 393400 ZFINID:ZDB-GENE-040426-1606 Length:512 Species:Danio rerio


Alignment Length:423 Identity:85/423 - (20%)
Similarity:139/423 - (32%) Gaps:160/423 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GTLEDFRTLIKRAKELDLKIVLDFVPNHSSNESEWFLKSVKREKGYEDYYVWHDGKVNSTTGKRE 168
            ||.|:.:.:|.|...:.:.|..|.|.||....|           |.|.        .:|:.|   
Zfish    89 GTEEELKDMIARCNNVGVNIYADAVINHMCGAS-----------GGEG--------THSSCG--- 131

  Fly   169 PPTNWLQYFRG----------SAWEWNEVR-------QQYYLHQFAVQQPDL----------NYR 206
                  .||..          |:|::|:.:       .:.|...|.|:...|          :|.
Zfish   132 ------TYFNAKNEDFPSVPYSSWDFNDNKCKTANEDIENYSDIFQVRDCRLVSLLDLALEKDYV 190

  Fly   207 NPLVVEQMKRVLRYWLNEGVSGFRCDALPPLFEVVPDSDGQFPDEVVSGATEDKEDRDYLTTTYI 271
            ...|.|.|.::    ::.||:|||.||...:          :|.::.:..:..|.    |..|:.
Zfish   191 RGKVAEYMNKL----IDIGVAGFRVDACKHM----------WPGDLSNVYSRLKT----LNNTWF 237

  Fly   272 ENQPETIDMVYQWRTVLDDHKRIFGGNSSVLLIETYSPAWFTMQFYGNRSTEGAHLPFNFNLITV 336
              .|.|...:||  .|:|     .||          .|...:......|.||   ..::..|.||
Zfish   238 --SPGTKPFIYQ--EVID-----LGG----------EPIKASEYVSLGRVTE---FKYSAKLGTV 280

  Fly   337 M---EQSGLSASNVQEAIDLWLKN-------MPAGRTPNWVLGNHDKRRAASRYGKENIDGM-NM 390
            :   |:..|          .:|||       ||:.:...:| .|||.:|.....|...:... :.
Zfish   281 IRKWEKEKL----------CYLKNWGEGWGFMPSDKALVFV-DNHDNQRGHGAGGASVLTFWDSR 334

  Fly   391 LVMILPGVSVTYQGEEIGMTDGEISWEDTVDPWGCNSNPNIYEQYTRDPERTPFQWTGGTNAGFT 455
            |..|..|:.:.:                   |:|..:..:.|            :|    :..|.
Zfish   335 LYKIATGLMLAH-------------------PYGVTAVMSSY------------RW----DRHFV 364

  Fly   456 NG--SSTWL--PLAADYAT----INVEKELSDD 480
            ||  .:.|:  |..||.:|    ||.:....|:
Zfish   365 NGKDQNDWMGPPSNADGSTKSVPINPDSTCGDN 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-A8NP_610384.1 AmyAc_maltase 30..506 CDD:200467 85/423 (20%)
trehalose_treC 33..585 CDD:274115 85/423 (20%)
Malt_amylase_C 487..585 CDD:295440
amy2al1NP_956722.1 AmyAc_bac_euk_AmyA 25..417 CDD:200456 85/423 (20%)
AmyA 46..>315 CDD:223443 63/304 (21%)
Aamy_C 424..511 CDD:214749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576520
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.