DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-A8 and Amyrel

DIOPT Version :9

Sequence 1:NP_610384.1 Gene:Mal-A8 / 35830 FlyBaseID:FBgn0033297 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_477262.1 Gene:Amyrel / 36863 FlyBaseID:FBgn0020506 Length:493 Species:Drosophila melanogaster


Alignment Length:561 Identity:106/561 - (18%)
Similarity:176/561 - (31%) Gaps:217/561 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTLLLLAIASNEACQVQSSSSETTKDWWQTAQFYQIYPRSFKDSDGDGIGDLNGITSKLE-YLKD 70
            |||.|....|       .|.::....||...... ::...:|.||         |..:.| :|..
  Fly     6 LTLTLCLAGS-------LSLAQHNPHWWGNRNTI-VHLFEWKWSD---------IAQECESFLGP 53

  Fly    71 LGVTAAWLSPIFKS------PMVDFGYDISDFFDIQPEYGTLEDFRTLIKRAKELDLKIVLDFVP 129
            .|.....:||:.::      |..:....||  :.:....|..|:|..:::|..::.::|.:|.:.
  Fly    54 RGFAGVQVSPVNENILSAGRPWWERYQPIS--YKLTTRSGNEEEFGDMVRRCNDVGVRIYVDVLL 116

  Fly   130 NHSSNESEWFLKSVKREKGYEDYYVWHDGKVNSTTGKREPPTNWLQYFRGSAW------------ 182
            ||.|.:                    .||....|.|....|:.  :.|.|..:            
  Fly   117 NHMSGD--------------------FDGVAVGTAGTEAEPSK--KSFPGVPYTAQDFHPTCEIT 159

  Fly   183 EWNEVRQQYYLHQFAVQQ------PDLNYRNPLVVEQMKRVLRYWLNEGVSGFRCDALPPL---- 237
            :||:        :|.|||      .||:..:..|..::...|.:.:..||:|||.||...:    
  Fly   160 DWND--------RFQVQQCELVGLKDLDQSSDWVRSKLIEFLDHLIELGVAGFRVDAAKHMASED 216

  Fly   238 FEVVPDS------DGQFPDEVVSGATEDKEDRDYLTTTYIENQPETIDMVYQWRTVLDDHKRIFG 296
            .|.:..|      |..||          ...|.::....|::..||:..        |::|.:  
  Fly   217 LEYIYSSLSNLNIDHGFP----------HNSRPFIFQEVIDHGHETVSR--------DEYKDL-- 261

  Fly   297 GNSSVLLIETYSPAWFTMQFYGNRSTEGAHLPFNFNLITVMEQSGLSASNVQEAIDLWLKN---- 357
                                       ||...|.|:     |:.| :|.....|:. ||::    
  Fly   262 ---------------------------GAVTEFRFS-----EEIG-NAFRGNNALK-WLQSWGTD 292

  Fly   358 ---MPAGRTPNWVLGNHDKRRAASRYGKENIDGMNMLVMILPGVSVTYQGEE------------- 406
               :|:|:...:| .|||.:|.|                   |..:.|:...             
  Fly   293 WGFLPSGQALTFV-DNHDNQRDA-------------------GAVLNYKSPRQYKMATAFHLAYP 337

  Fly   407 --IGMTDGEISWED-----------------------TVDPWGCNSN-PNIY-----EQYTRDPE 440
              |.......:::|                       .|:.|.|... ..||     :...||.|
  Fly   338 YGISRVMSSFAFDDHDTPPPQDAQERIISPEFDADGACVNGWICEHRWRQIYAMVGFKNAVRDTE 402

  Fly   441 RTPFQWTGGTN-AGFTNGSSTWLPLAADYATINVEKELSDD 480
            .|.: |..|.| ..|..|:..:|      |..|...:||.|
  Fly   403 ITGW-WDNGDNQISFCRGNKGFL------AINNNLYDLSQD 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-A8NP_610384.1 AmyAc_maltase 30..506 CDD:200467 100/538 (19%)
trehalose_treC 33..585 CDD:274115 100/535 (19%)
Malt_amylase_C 487..585 CDD:295440
AmyrelNP_477262.1 AmyAc_bac_euk_AmyA 29..398 CDD:200456 83/484 (17%)
Aamy_C 404..492 CDD:214749 12/40 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443618
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.