DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-A8 and AMY1A

DIOPT Version :9

Sequence 1:NP_610384.1 Gene:Mal-A8 / 35830 FlyBaseID:FBgn0033297 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001008222.1 Gene:AMY1A / 276 HGNCID:474 Length:511 Species:Homo sapiens


Alignment Length:512 Identity:103/512 - (20%)
Similarity:170/512 - (33%) Gaps:182/512 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GTLEDFRTLIKRAKELDLKIVLDFVPNH----------SSNESEWFLKSVKREKGYED-----YY 153
            |..::||.::.|...:.::|.:|.|.||          ||....:|      ..|..|     |.
Human    89 GNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYF------NPGSRDFPAVPYS 147

  Fly   154 VW--HDGKVNSTTGKREPPTNWLQYFRGSAWEWNEVRQQYYLHQFAVQQPDLNYRNPLVVEQMKR 216
            .|  :|||..:.:|..|   |:     ..|.:..:.|....|        ||......|..::..
Human   148 GWDFNDGKCKTGSGDIE---NY-----NDATQVRDCRLSGLL--------DLALGKDYVRSKIAE 196

  Fly   217 VLRYWLNEGVSGFRCDALPPLFEVVPDSDGQFPDEVVSGATEDKEDRDYLTTTYIENQPE-TIDM 280
            .:.:.::.||:|||.||          |...:|.::       |...|.|........|| :...
Human   197 YMNHLIDIGVAGFRIDA----------SKHMWPGDI-------KAILDKLHNLNSNWFPEGSKPF 244

  Fly   281 VYQWRTVLDDHKRIFGG---NSSVLLIETYSPAWFTMQFYGN-RSTEGAHLPFNFNLITVMEQ-S 340
            :||  .|:|     .||   .||              .::|| |.||   ..:...|.||:.: :
Human   245 IYQ--EVID-----LGGEPIKSS--------------DYFGNGRVTE---FKYGAKLGTVIRKWN 285

  Fly   341 GLSASNVQEAIDLWLKN-------MPAGRTPNWVLGNHDKRRAASRYGKENIDGMN-MLVMILPG 397
            |...|        :|||       ||:.|...:| .|||.:|.....|...:...: .|..:..|
Human   286 GEKMS--------YLKNWGEGWGFMPSDRALVFV-DNHDNQRGHGAGGASILTFWDARLYKMAVG 341

  Fly   398 VSVTY------------------QGEEIG-----MTDGEISWEDTVDP-------WGCNSNPNIY 432
            ..:.:                  .|:::.     ..|..::.|.|::|       |.|...   :
Human   342 FMLAHPYGFTRVMSSYRWPRYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHR---W 403

  Fly   433 EQ------YTRDPERTPF-QW--TGGTNAGFTNGS-----------------STWLPLAADYATI 471
            .|      :....:..|| .|  .|.....|..|:                 .|.|| |..|..:
Human   404 RQIRNMVNFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLP-AGTYCDV 467

  Fly   472 NVEKELSDDHSHLKIY-----KALVALRKSSKTLQNGSTKYQALSEDIFVVQRSLTK 523
            ....:::.:.:.:|||     ||..::..|              :||.|:...:.:|
Human   468 ISGDKINGNCTGIKIYVSDDGKAHFSISNS--------------AEDPFIAIHAESK 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-A8NP_610384.1 AmyAc_maltase 30..506 CDD:200467 99/493 (20%)
trehalose_treC 33..585 CDD:274115 103/512 (20%)
Malt_amylase_C 487..585 CDD:295440 8/42 (19%)
AMY1ANP_001008222.1 AmyAc_bac_euk_AmyA 25..416 CDD:200456 82/401 (20%)
Aamy_C 422..510 CDD:214749 18/102 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143630
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.