DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-A8 and Amy1a

DIOPT Version :9

Sequence 1:NP_610384.1 Gene:Mal-A8 / 35830 FlyBaseID:FBgn0033297 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001010970.1 Gene:Amy1a / 24203 RGDID:2113 Length:521 Species:Rattus norvegicus


Alignment Length:298 Identity:68/298 - (22%)
Similarity:111/298 - (37%) Gaps:94/298 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GTLEDFRTLIKRAKELDLKIVLDFVPNH----------SSNESEWFLKSVKREKG--YEDYYVWH 156
            |..::||.::.|...:.::|.:|.|.||          ||....:|..:.:...|  |.. :.::
  Rat    99 GNEDEFRDMVNRCNNVGVRIYVDAVINHMCGVGAEAGQSSTCGSYFNPNNRDFPGVPYSG-FDFN 162

  Fly   157 DGKVNSTTGKREPPTNWLQYFRGSAWEWNEVRQQYYLHQFAVQQPDLNYRNPLVVEQMKRVLRYW 221
            |||..:.:|..|   |:     ..|.:..:.|....|        ||......|..::...:.:.
  Rat   163 DGKCKTGSGGIE---NY-----NDAAQVRDCRLSGLL--------DLALEKDYVRTKVADYMNHL 211

  Fly   222 LNEGVSGFRCDALPPLFEVVPDSDGQFPDEVVSGATEDKEDRDYLTTTYIE--NQPETIDMVYQW 284
            ::.||:|||.||          |...:|.::  .|..||...  |.|.:..  ::|    .:|| 
  Rat   212 IDIGVAGFRLDA----------SKHMWPGDI--KAVLDKLHN--LNTKWFSEGSKP----FIYQ- 257

  Fly   285 RTVLDDHKRIFGGNSSVLLIETYSPAWFTMQFYGN-RSTEGAHLPFNFNLITVMEQSGLSASNVQ 348
             .|:|     .||.           |..:.:::|| |.||     |.:         |.....|.
  Rat   258 -EVID-----LGGE-----------AVSSNEYFGNGRVTE-----FKY---------GAKLGKVL 291

  Fly   349 EAID----LWLKN-------MPAGRTPNWVLGNHDKRR 375
            ...|    .:|||       ||:.|...:| .|||.:|
  Rat   292 RKWDGEKMAYLKNWGEGWGFMPSDRALVFV-DNHDNQR 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-A8NP_610384.1 AmyAc_maltase 30..506 CDD:200467 68/298 (23%)
trehalose_treC 33..585 CDD:274115 68/298 (23%)
Malt_amylase_C 487..585 CDD:295440
Amy1aNP_001010970.1 AmyAc_bac_euk_AmyA 35..426 CDD:200456 68/298 (23%)
AmyA 56..>325 CDD:223443 65/293 (22%)
Aamy_C 432..520 CDD:214749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337370
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.