DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-A8 and Amy2a3

DIOPT Version :9

Sequence 1:NP_610384.1 Gene:Mal-A8 / 35830 FlyBaseID:FBgn0033297 Length:588 Species:Drosophila melanogaster
Sequence 2:NP_001153623.1 Gene:Amy2a3 / 100043686 MGIID:3714985 Length:508 Species:Mus musculus


Alignment Length:358 Identity:71/358 - (19%)
Similarity:118/358 - (32%) Gaps:129/358 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GTLEDFRTLIKRAKELDLKIVLDFVPNHSSNESEWFLKSVKREKGYEDYYVWHDGKVNSTTGKRE 168
            |..::||.::.|...:.::|.:|.|.||.....                   :....:||.|...
Mouse    89 GNEDEFRDMVTRCNNVGVRIYVDAVINHMCGAG-------------------NPAGTSSTCGSYL 134

  Fly   169 PPTNWLQYFRG---SAWEWNEVR----QQYYLHQFAVQQ------PDLNYRNPLVVEQMKRVLRY 220
            .|.|  :.|..   |||::|:.:    ...|...:.|:.      .||......|..::...:.:
Mouse   135 NPNN--REFPAVPYSAWDFNDNKCNGEIDNYNDAYQVRNCRLTGLLDLALEKDYVRTKVADYMNH 197

  Fly   221 WLNEGVSGFRCDAL----------------------------PPLFEVVPDSDGQFPDEVVSGA- 256
            .::.||:|||.||.                            |.:|:.|.|..|    |.:.|: 
Mouse   198 LIDIGVAGFRLDAAKHMWPGDIKAVLDKLHNLNTKWFSQGSRPFIFQEVIDLGG----EAIKGSE 258

  Fly   257 -------TEDKEDRDYLTT---------TYIENQPETIDMVYQWRTV--LDDHKRIFG---GNSS 300
                   ||.|......|.         :|::|..|...:|...|.:  :|:|....|   |.||
Mouse   259 YFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGLVPSDRALVFVDNHDNQRGHGAGGSS 323

  Fly   301 VLLIETYSPAWFTMQFYGNRSTEG---AHLPFNFNLITVMEQSGLSASNVQEAIDLWLKNMPAGR 362
            :|..      |....:   :...|   || |:.|..:       :|:..       |.:|...|:
Mouse   324 ILTF------WDARMY---KMAVGFMLAH-PYGFTRV-------MSSYR-------WNRNFQNGK 364

  Fly   363 TPN-WVLGNHDKRRAASRYGKENIDGMNMLVMI 394
            ..| |:             |..|.:|:...|.|
Mouse   365 DQNDWI-------------GPPNNNGVTKEVTI 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-A8NP_610384.1 AmyAc_maltase 30..506 CDD:200467 71/358 (20%)
trehalose_treC 33..585 CDD:274115 71/358 (20%)
Malt_amylase_C 487..585 CDD:295440
Amy2a3NP_001153623.1 AmyAc_bac_euk_AmyA 25..413 CDD:200456 71/358 (20%)
AmyA 46..>344 CDD:223443 58/289 (20%)
Aamy_C 420..507 CDD:214749
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833767
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.