DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-A7 and amy2al2

DIOPT Version :9

Sequence 1:NP_001286198.1 Gene:Mal-A7 / 35829 FlyBaseID:FBgn0033296 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001003729.1 Gene:amy2al2 / 445049 ZFINID:ZDB-GENE-040801-179 Length:512 Species:Danio rerio


Alignment Length:453 Identity:95/453 - (20%)
Similarity:144/453 - (31%) Gaps:156/453 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 GTLDDFRALIKRANELDLKIILDFVPNH----------SSDENSWFVKSVNREK------GYEDY 157
            ||..:.:.:|.|.|.:.:.|..|.|.||          .|...|.|  ..|:|.      .|.|:
Zfish    89 GTEAELKDMITRCNNVGVNIYADVVINHMCKSIHGAGTPSSCGSHF--DANKEDFPTVPYSYLDF 151

  Fly   158 YVWHDGRVNATTGGREPPSNWLQAFRGSAWEWNEKRQQYYLHQFAVQQADLNYRNPLVVEQMKRV 222
               :||:..:.:|..|..::..|.        .:.|.:..|        ||......|..::...
Zfish   152 ---NDGKCKSASGQIESYNDIYQV--------RDCRLEDLL--------DLALEKDYVRGKVAEY 197

  Fly   223 LRYWLDLGVAGFRCDAVPVLFEIEPDADGQYADEELSGLTDDVDDRKYLKSDLIENRP----ETI 283
            |...::|||||||.||...::  ..|....|:  .|..|     :.|:..|.   .:|    |.|
Zfish   198 LNKLIELGVAGFRVDACKHMW--PGDLSNVYS--RLKTL-----NTKWFPSG---TKPFIYQEVI 250

  Fly   284 DMAYQWRVVMDDYQRIHGGETRVLLIETYAPPAYTMQFYG-NRSTAGAHLPFNFNLITVLASDGV 347
            |:               |||           |....::|| .|.|...|                
Zfish   251 DL---------------GGE-----------PIKASEYYGLARVTEFKH---------------- 273

  Fly   348 SAGSIKTAVDNWLDNLPAGRTANW--------------VIGNHDQRRAASRYGTANADAM----N 394
             :..|.|||..| |........||              .:.|||.:|.   :|...|..:    :
Zfish   274 -SAKIGTAVRKW-DGEKLSYLKNWGEGWGFMPSDKALVFVDNHDNQRG---HGAGGASVLTFWDS 333

  Fly   395 MLVMVLPGASV-----------TYQ-------GEELGMTDGEISWED-TQDPAACNSNSDI---- 436
            .|..:..|..:           :||       |::.....|..|:.| :..|...|.:|..    
Zfish   334 RLYKMAAGFMLAHPYGVTRVMSSYQWDRKIVNGKDENDWMGPPSFSDGSTKPVPINPDSTCGDGW 398

  Fly   437 -----YEQ------FTRDPSRTP-FQWTNGTNA--GFSTASKTWLPLAADYQTLNVETEAAAQ 485
                 :.|      |....:..| |.|.:..|:  .||..||.::.:..|...||.......|
Zfish   399 VCEHRWRQIRNMVIFRNVVNGQPLFNWWDNGNSQIAFSRGSKGFIVINNDNWELNATLNTGLQ 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-A7NP_001286198.1 AmyAc_maltase 36..511 CDD:200467 95/453 (21%)
trehalose_treC 38..547 CDD:274115 95/453 (21%)
amy2al2NP_001003729.1 AmyAc_bac_euk_AmyA 25..417 CDD:200456 83/407 (20%)
Aamy_C 424..511 CDD:214749 10/38 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576517
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.