DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-A7 and slc3a2b

DIOPT Version :9

Sequence 1:NP_001286198.1 Gene:Mal-A7 / 35829 FlyBaseID:FBgn0033296 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_958922.2 Gene:slc3a2b / 399488 ZFINID:ZDB-GENE-040122-2 Length:504 Species:Danio rerio


Alignment Length:400 Identity:82/400 - (20%)
Similarity:128/400 - (32%) Gaps:157/400 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DWWENAQFYQIYPRSFMDSDGDGIG------DLNGITSKLEYLKDLGVTAAWLSPIFTSPMVDFG 95
            :||.|...|||         || :|      |:..:..|::.|.||.|....:.||..| ..|..
Zfish   112 NWWNNGPLYQI---------GD-VGAFTNSSDIKDLAGKVQALDDLKVKGLIIGPIHVS-SEDKP 165

  Fly    96 YDISDFFDIQPEYGTLDDFRALIKRANELDLKIILDFVPNHSSDENSWFVKSVNREKGYEDYYVW 160
            .:: :...|..:.|.|..|:.:|..|::..:.:|||..||:.. ::.||..:||           
Zfish   166 NEL-NLIKISEDDGVLAQFKEVITAAHKRGISVILDLTPNYKG-KDPWFSDAVN----------- 217

  Fly   161 HDGRVNATTGGREPPSNWLQAFRGSAWEWNEKRQQYYLHQFAVQQADLNYRNPLVVEQMKRVLRY 225
                                                                  .|::::..|.:
Zfish   218 ------------------------------------------------------TVQKVEPALIF 228

  Fly   226 WLDLGVAGFR-------CDAVP-------VLFEIEPDADGQYADEELSGLTDDVDDRKYLKSDLI 276
            ||..||.||.       ..|.|       .|...:.||:|: ..:.|.|:||             
Zfish   229 WLKQGVDGFLFYGVEKVAAAAPTFWSDVVALIHNQTDAEGK-TKKVLIGVTD------------- 279

  Fly   277 ENRPETIDMAYQWRVVMDDYQRIHGGETRVLLIETYAPPAYTMQFYGNRSTAGAHLPFNFNLITV 341
            ::.||.|....              .:|.|.|:                 .:||           
Zfish   280 QSSPEEISATL--------------NKTGVDLL-----------------LSGA----------- 302

  Fly   342 LASDGVSAGSIKTAVDNWLDNLPAGRTANWVIGNHDQRRAASRYGTANADAMNMLVMVLPGASVT 406
            |.|..|.  .:..||::........|.| |.||.......||..|.|......::::.|||..|.
Zfish   303 LRSKSVQ--EVAQAVESLYSTYNQTRLA-WNIGGRIAGHLASVVGFAKVKLSQLMLLTLPGTPVF 364

  Fly   407 YQGEELGMTD 416
            ..|:|:|:.|
Zfish   365 NYGDEIGLED 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-A7NP_001286198.1 AmyAc_maltase 36..511 CDD:200467 81/399 (20%)
trehalose_treC 38..547 CDD:274115 81/398 (20%)
slc3a2bNP_958922.2 SLC3A2_N 49..119 CDD:292647 3/6 (50%)
AmyAc_SLC3A2 103..415 CDD:200483 81/399 (20%)
AmyA 133..471 CDD:223443 72/368 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576538
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384693at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R680
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.