DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-A1 and amy2al2

DIOPT Version :9

Sequence 1:NP_476627.3 Gene:Mal-A1 / 35824 FlyBaseID:FBgn0002570 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_001003729.1 Gene:amy2al2 / 445049 ZFINID:ZDB-GENE-040801-179 Length:512 Species:Danio rerio


Alignment Length:550 Identity:113/550 - (20%)
Similarity:184/550 - (33%) Gaps:162/550 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 QYLKDIGFTGTWLSPIFK--------SPMVDFGYDISDFYQIHPEYGTMEDFERMIAKAKEVGIK 111
            :||...|:.|..:||..:        .|.......||  |.:....||..:.:.||.:...||:.
Zfish    45 RYLAPNGYGGVQISPPSEHVKLTNPWHPWWQRYQPIS--YNLCSRSGTEAELKDMITRCNNVGVN 107

  Fly   112 IILDFVPNH-----------SSTENEWFTKSVDSDPVYKDFYIWHDGKINNETGEREPPSNWNSE 165
            |..|.|.||           ||..:.:.....|...|...:..::|||..:.:|:.|        
Zfish   108 IYADVVINHMCKSIHGAGTPSSCGSHFDANKEDFPTVPYSYLDFNDGKCKSASGQIE-------- 164

  Fly   166 FRYSAWEWNEVRQQYYLHQFAIQQ-ADLNYRNPAVVNEMKNVIRFWLGKGVSGFRIDAVPYLFEV 229
                  .:|::   |.:....::. .||......|..::...:...:..||:|||:||..:::..
Zfish   165 ------SYNDI---YQVRDCRLEDLLDLALEKDYVRGKVAEYLNKLIELGVAGFRVDACKHMWPG 220

  Fly   230 DLDRYNQYPDEPLTNDSVNCPDPDDHCYTQHIYTQDMPE-TIDMVYQWRELVDEFHVENGGDKRL 293
            ||.  |.|......|                  |:..|. |...:||  |::|.      |.:.:
Zfish   221 DLS--NVYSRLKTLN------------------TKWFPSGTKPFIYQ--EVIDL------GGEPI 257

  Fly   294 LMTEAY-----TSFENIMTYYGNGVRNGSHIPFNFDFLTSINNASKAGEYVEHIKKWMDA---MP 350
            ..:|.|     |.|:: ....|..||...                  ||.:.::|.|.:.   ||
Zfish   258 KASEYYGLARVTEFKH-SAKIGTAVRKWD------------------GEKLSYLKNWGEGWGFMP 303

  Fly   351 EGVYANWVLGNHDNKRVASRFGVQRTDLINILLQTLPGHAVTYNGEELGMTDVWISWEDTVDPNA 415
            ......:| .||||:|                     ||..       |...|...|:..:...|
Zfish   304 SDKALVFV-DNHDNQR---------------------GHGA-------GGASVLTFWDSRLYKMA 339

  Fly   416 CNSDPDNYYARSRDPARSPYQWDASSKAGFTSADHTWL-----------PV--------ADDYKT 461
            ......:.|..:|  ..|.||||.....|  ..::.|:           ||        .|.:..
Zfish   340 AGFMLAHPYGVTR--VMSSYQWDRKIVNG--KDENDWMGPPSFSDGSTKPVPINPDSTCGDGWVC 400

  Fly   462 NNALQQLRAPRSHLQIFKKLVRVRKEPSFRQGELNIQAIDDDVIIYSRQKTGSDLYVIVLNLGST 526
            .:..:|:|    ::.||:.:  |..:|.|     |.....:..|.:||...|    .||:|..:.
Zfish   401 EHRWRQIR----NMVIFRNV--VNGQPLF-----NWWDNGNSQIAFSRGSKG----FIVINNDNW 450

  Fly   527 SKTLDLTKYYELGTQAEVITTSLSSQYIDG 556
            .....|....:.||..::|:...|.....|
Zfish   451 ELNATLNTGLQSGTYCDIISGEKSGNSCTG 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-A1NP_476627.3 AmyAc_maltase 21..496 CDD:200467 99/488 (20%)
Alpha-amylase 45..404 CDD:278554 77/377 (20%)
amy2al2NP_001003729.1 AmyAc_bac_euk_AmyA 25..417 CDD:200456 96/476 (20%)
Aamy_C 424..511 CDD:214749 13/60 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.