DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-A1 and CG10949

DIOPT Version :9

Sequence 1:NP_476627.3 Gene:Mal-A1 / 35824 FlyBaseID:FBgn0002570 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_001286101.1 Gene:CG10949 / 35310 FlyBaseID:FBgn0032858 Length:459 Species:Drosophila melanogaster


Alignment Length:403 Identity:84/403 - (20%)
Similarity:137/403 - (33%) Gaps:137/403 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 FEVDLDRYNQYPDEPLTNDSVNCPDP-----DDHCYTQHIYTQDMP--ETID-MVYQWRELVDEF 283
            |..:..|:.:.||||...|..    |     .||      |.|.:.  |::| |.::.||.....
  Fly    60 FGKEFRRFQERPDEPTYWDMF----PRLLFLKDH------YKQGLARNESLDGMRFEPRERKKRT 114

  Fly   284 HVENGGDKRLLMTEAYTSFENIMTYYGNGVRN-------GSHIPFNFD---FLTSINNASKAGEY 338
            .|:...::|....|...|.::::        |       .|| |..:|   ...|.|.|:| .|.
  Fly   115 KVDMEQERRRKDEEEEDSQDDLL--------NEQLIELVKSH-PVLYDRHKIRVSKNLAAK-NEA 169

  Fly   339 VEHIKKWMDAMPEGVYANWVLGNHDNKRVASRFGVQ-RTDLINILLQTLPGHAVTYNGEELGMTD 402
            ...|.:.::...|..|..|       |::..|||.: |:..||   |:.|               
  Fly   170 WREISENLNVSEELCYNRW-------KKLRDRFGREFRSHQIN---QSTP--------------- 209

  Fly   403 VWISWEDTVD------------PNACNSDPDNYYARSRDP-ARSPYQWDASSKAG--FTSADHTW 452
              |:|....|            |...    :|...|.|.| |.:|....:....|  .:|.:..|
  Fly   210 --ITWRYFNDLLFLGRHFRKGVPLVL----ENIKRRGRPPKAGNPSGKTSKQPEGMVISSGEQIW 268

  Fly   453 LPVAD-DYKTNNALQQLRAPRSHLQIFKKLVRVRKEPSFRQGELNIQAIDDDVIIYSRQKTGSDL 516
              .|| .|.|:|                         ...:.:|.: |.|:::.|.|..:..:. 
  Fly   269 --GADYPYSTDN-------------------------DDLEDDLEL-AYDEEIEILSEAEQATP- 304

  Fly   517 YVIVLNLGSTSKTLDLTKYYEL-----GTQAEVITTSL-------SSQYIDGDVIKS-------- 561
            |..:|:..:..:.|:..:..::     .|..|:|.|..       .|..:.||.:.|        
  Fly   305 YDFILSEATARQDLEPPQQLQVTTTTPATSEEIIHTIARVNPVVEESSSLPGDSVPSAAISDKLL 369

  Fly   562 TEFVANPYVGTVL 574
            |..:||  :.|||
  Fly   370 TTVIAN--METVL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-A1NP_476627.3 AmyAc_maltase 21..496 CDD:200467 62/303 (20%)
Alpha-amylase 45..404 CDD:278554 44/195 (23%)
CG10949NP_001286101.1 MADF 5..91 CDD:214738 10/40 (25%)
MADF 140..226 CDD:214738 25/114 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.