DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-A1 and Amy1a

DIOPT Version :9

Sequence 1:NP_476627.3 Gene:Mal-A1 / 35824 FlyBaseID:FBgn0002570 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_001010970.1 Gene:Amy1a / 24203 RGDID:2113 Length:521 Species:Rattus norvegicus


Alignment Length:634 Identity:129/634 - (20%)
Similarity:225/634 - (35%) Gaps:222/634 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLAIVGFVGATEWWESGNYYQIYPRS-------FRDSDGDGIGDLNGVTEKLQ-YLKDIGFTGT 65
            |||:::|..     |...:.:..|.||       :|..|         :.::.: ||...||.|.
  Rat    15 LLLSLIGLC-----WAQYDPHTFYGRSSIVHLFEWRWVD---------IAKECERYLAPNGFGGV 65

  Fly    66 WLSPIFKSPMVDFGY--------DISDFYQIHPEYGTMEDFERMIAKAKEVGIKIILDFVPNH-- 120
            .:||..::.:|:..:        .||  |:|....|..::|..|:.:...||::|.:|.|.||  
  Rat    66 QVSPPNENIVVNSPFRPWWERYQPIS--YKICSRSGNEDEFRDMVNRCNNVGVRIYVDAVINHMC 128

  Fly   121 --------SSTENEWFTKSVDSDPVYKDF-------YIWHDGKINNETGEREPPSNWNS-----E 165
                    |||...:|      :|..:||       :.::|||....:|..|   |:|.     :
  Rat   129 GVGAEAGQSSTCGSYF------NPNNRDFPGVPYSGFDFNDGKCKTGSGGIE---NYNDAAQVRD 184

  Fly   166 FRYSAWEWNEVRQQYYLHQFAIQQADLNYRNPAVVNEMKNVIRFWLGKGVSGFRIDAVPYLFEVD 230
            .|.|.           |...|:::   :|....|.:.|.::|..    ||:|||:||        
  Rat   185 CRLSG-----------LLDLALEK---DYVRTKVADYMNHLIDI----GVAGFRLDA-------- 223

  Fly   231 LDRYNQYPDEPLTNDSVNCPDPDDHCYTQHIYTQDMPETIDMVY----QW-----RELVDEFHVE 286
                                       ::|::..|:...:|.::    :|     :..:.:..::
  Rat   224 ---------------------------SKHMWPGDIKAVLDKLHNLNTKWFSEGSKPFIYQEVID 261

  Fly   287 NGGDKRLLMTEAYTSFENIMTYYGNGVRNGSHIPFNFDFLTSINNASKAGEYVEHIKKWMDAMPE 351
            .||       ||.:|.|    |:|||            .:|.....:|.|:.   ::|| |....
  Rat   262 LGG-------EAVSSNE----YFGNG------------RVTEFKYGAKLGKV---LRKW-DGEKM 299

  Fly   352 GVYANWVLG--------------NHDNKRVASRFGVQRTDLINILLQTLPGHAVTYN-GEELGMT 401
            ....||..|              ||||:|   ..|...:.::......|...||.:. ....|.|
  Rat   300 AYLKNWGEGWGFMPSDRALVFVDNHDNQR---GHGAGGSSILTFWDARLYKMAVGFMLAHPYGFT 361

  Fly   402 DVWIS--W----EDTVDPNACNSDPDNYYARSRDPARSPYQWDASSKAGFTSADHTWLPVADDYK 460
            .|..|  |    |:..|.|.....|:|               :.::|....::|.|   ..:|:.
  Rat   362 RVMSSFHWPRYFENGKDVNDWVGPPNN---------------NGATKEVTINSDST---CGNDWV 408

  Fly   461 TNNALQQLRAPRSHLQIFKKLVRVRKEPSFRQGELNIQAIDDDVIIYSRQKTGSDLYVIVLNLGS 525
            ..:..:|:|    ::..|:.:|..:...::.....|       .:.:.|...|    .||.|   
  Rat   409 CEHRWRQIR----NMVAFRNVVNGQPFANWWDNGSN-------QVAFGRGNKG----FIVFN--- 455

  Fly   526 TSKTLDLTKYYELGTQAEVITTSLSSQYIDGDV--IKSTEFVANPYVGT 572
             :...||:...:.|..|......:|...:||:.  ||       .|||:
  Rat   456 -NDDWDLSTTLQTGLPAGTYCDVISGDKVDGNCTGIK-------VYVGS 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-A1NP_476627.3 AmyAc_maltase 21..496 CDD:200467 107/542 (20%)
Alpha-amylase 45..404 CDD:278554 85/413 (21%)
Amy1aNP_001010970.1 AmyAc_bac_euk_AmyA 35..426 CDD:200456 104/515 (20%)
AmyA 56..>325 CDD:223443 75/359 (21%)
Aamy_C 432..520 CDD:214749 18/87 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.