DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mal-A1 and Amy1

DIOPT Version :9

Sequence 1:NP_476627.3 Gene:Mal-A1 / 35824 FlyBaseID:FBgn0002570 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_001103975.1 Gene:Amy1 / 11722 MGIID:88019 Length:511 Species:Mus musculus


Alignment Length:627 Identity:127/627 - (20%)
Similarity:216/627 - (34%) Gaps:213/627 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLAIVGFVGATEWWESGNYYQIYPRS-------FRDSDGDGIGDLNGVTEKLQ-YLKDIGFTGT 65
            |||:::||.     |...:.:..|.|:       :|..|         :.::.: ||...||.|.
Mouse     5 LLLSLIGFC-----WAQYDPHTQYGRTAIVHLFEWRWVD---------IAKECERYLAPNGFAGV 55

  Fly    66 WLSP-----IFKSPMVDFG---YDISDFYQIHPEYGTMEDFERMIAKAKEVGIKIILDFVPNH-- 120
            .:||     :..||...:.   ..||  |:|....|..::|..|:.:...||::|.:|.|.||  
Mouse    56 QVSPPNENIVVHSPSRPWWERYQPIS--YKICSRSGNEDEFRDMVNRCNNVGVRIYVDAVINHMC 118

  Fly   121 --------SSTENEWFTKSVDSDPVYKDF-------YIWHDGKINNETGEREPPSNWNS-----E 165
                    |||...:|      :|..:||       :.::|||....:|..|   |:..     :
Mouse   119 GVGAQAGQSSTCGSYF------NPNNRDFPGVPYSGFDFNDGKCRTASGGIE---NYQDAAQVRD 174

  Fly   166 FRYSAWEWNEVRQQYYLHQFAIQQADLNYRNPAVVNEMKNVIRFWLGKGVSGFRIDAVPYLFEVD 230
            .|.|.           |...|:::   :|....|.:.|.::|..    ||:|||:||        
Mouse   175 CRLSG-----------LLDLALEK---DYVRTKVADYMNHLIDI----GVAGFRLDA-------- 213

  Fly   231 LDRYNQYPDEPLTNDSVNCPDPDDHCYTQHIYTQDMPETIDMVY----QW-----RELVDEFHVE 286
                                       ::|::..|:...:|.::    :|     |..:.:..::
Mouse   214 ---------------------------SKHMWPGDIKAILDKLHNLNTKWFSQGSRPFIFQEVID 251

  Fly   287 NGGDKRLLMTEAYTSFENIMTYYGNGVRNGSHIPFNFDFLTSINNASKAGEYVEHIKKWMDAMPE 351
            .||       ||.:|.|    |:|||            .:|.....:|.|:.   ::|| |....
Mouse   252 LGG-------EAVSSNE----YFGNG------------RVTEFKYGAKLGKV---MRKW-DGEKM 289

  Fly   352 GVYANWVLG--------------NHDNKRVASRFGVQRTDLINILLQTLPGHAVTYN-GEELGMT 401
            ....||..|              ||||:|   ..|.....::......|...||.:. ....|.|
Mouse   290 SYLKNWGEGWGLMPSDRALVFVDNHDNQR---GHGAGGASILTFWDARLYKMAVGFMLAHPYGFT 351

  Fly   402 DVWISWEDTVDPNACNSDPDNYYARSRDPARSPYQW------DASSKAGFTSADHTWLPVADDYK 460
            .|..|:               |:.|:....:....|      :..:|....:.|.|   ..:|:.
Mouse   352 RVMSSY---------------YWPRNFQNGKDVNDWVGPPNNNGKTKEVSINPDST---CGNDWI 398

  Fly   461 TNNALQQLRAPRSHLQIFKKLVRVRKEPSFRQGELNIQAIDDDVIIYSRQKTGSDLYVIVLNLGS 525
            ..:..:|:|    ::..|:.:|.       .|...|....|.:.:.:.|...|    .||.|...
Mouse   399 CEHRWRQIR----NMVAFRNVVN-------GQPFANWWDNDSNQVAFGRGNKG----FIVFNNDD 448

  Fly   526 TSKTLDLTKYYELGTQAEVITTSLSSQYIDGDVIKSTEFVAN 567
            .:.:..|......||..:||    |...:||:......:|.|
Mouse   449 WALSETLQTGLPAGTYCDVI----SGDKVDGNCTGIKVYVGN 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mal-A1NP_476627.3 AmyAc_maltase 21..496 CDD:200467 105/542 (19%)
Alpha-amylase 45..404 CDD:278554 86/413 (21%)
Amy1NP_001103975.1 AmyAc_bac_euk_AmyA 25..416 CDD:200456 101/515 (20%)
AmyA 46..>315 CDD:223443 76/359 (21%)
Aamy_C 422..510 CDD:214749 17/73 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.