DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e2 and CYP96A8

DIOPT Version :9

Sequence 1:NP_001286196.1 Gene:Cyp4e2 / 35822 FlyBaseID:FBgn0014469 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_175193.1 Gene:CYP96A8 / 841171 AraportID:AT1G47620 Length:520 Species:Arabidopsis thaliana


Alignment Length:485 Identity:106/485 - (21%)
Similarity:198/485 - (40%) Gaps:133/485 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 W--IGTYSNVLVTSSKYLEFILSSQTLITKSDIYQLTHPW-LGLGLLTSTGSKWHKHRKMITPAF 135
            |  :|....||:...:..:  .|.:.|...:..:|...|| :|:.:|.:           :.|| 
plant    44 WPVLGMLPGVLLRLQRIYD--CSVEVLENSNMTFQFKGPWFVGMDVLAT-----------VDPA- 94

  Fly   136 HFNILQDFHEVMNENSTKFIK----HLKTVAAGDNIFD----------------FQEQA------ 174
                  :.|.:|:.|.:.:||    |....|.||.|.:                |..|.      
plant    95 ------NIHHIMSSNFSNYIKGPIFHEIFEAFGDGIINTDAELWRDWRNASQLIFNHQRYQNFSA 153

  Fly   175 ----------------HYLTLDVICD----------TAMGVSINAMENRSSSI-------VQAFK 206
                            |:...:::.|          ....:.|...:.||.||       .:|..
plant   154 STTKTKVNDGLVPLFNHFANEEIVVDLEDVFQRFMYDITFIFITGTDPRSLSIEMPEVEFSKALD 218

  Fly   207 DMCYNINMRAFHPLKRNELLYRLAP--DYPAYSRTLK---TLQDFTNEIIAKRIEAHKSGAVSTN 266
            |:...|..|...|    ..:::|..  ......:.||   |......:|||.:.|...|..::.|
plant   219 DVGDAIVHRHITP----RFVWKLQKWIGIGTEKKMLKAHATFDRVCEKIIAAKREELGSQGITYN 279

  Fly   267 AGDEFTRKKMAFLDTLLSSTI--DG------RPLNSKELYEEVSTFMFEGHDTTTSGVSFAVYLL 323
            :..|        .:.||:|.|  |.      :|.:.|.|.:....||..|.|:|.|.:::..:.|
plant   280 SNGE--------REDLLTSFIKLDATKYEVLKPSHDKFLRDFTIGFMAAGRDSTASTLTWFFWNL 336

  Fly   324 SRHQDEQRKLFKEQREVMGNSELGRDATFQEIS----QMKYLDLFIKEAQRVYPSVPFIGRFTEK 384
            |::.:...|:.:|.     |:.|.|..:.|::|    ::.||...:.|:.|:||.:||     ::
plant   337 SKNPNVLTKILQEI-----NTNLPRTGSDQDMSSYLNKLVYLHGALSESMRLYPPIPF-----QR 391

  Fly   385 DYVIDGDLVPKG----TTLNLGLVM--LGYNEKVF-KDPHKFRPERFELEKPG-----PFEYVPF 437
            ...|..|::|.|    :.:|:.:.:  :|..:.:: :|..:|:|||:..|..|     .::::.|
plant   392 KSPIKEDVLPSGHKVKSNINIMIFIYAMGRMKTIWGEDAMEFKPERWISETGGVRHEPSYKFLSF 456

  Fly   438 SAGPRNCIGQKFALLEIKTVVSKIIRNFEV 467
            :||||.|:|:..|:..:|||:.:|::|:|:
plant   457 NAGPRTCLGKNLAMNLMKTVIVEILQNYEI 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e2NP_001286196.1 p450 35..469 CDD:278495 106/485 (22%)
CYP96A8NP_175193.1 p450 1..515 CDD:386267 106/485 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H111093
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.