DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e2 and CYP72C1

DIOPT Version :9

Sequence 1:NP_001286196.1 Gene:Cyp4e2 / 35822 FlyBaseID:FBgn0014469 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:214 Identity:58/214 - (27%)
Similarity:91/214 - (42%) Gaps:35/214 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IFLALPLLL--------VAYLELSTFRRRRVLNK--FNGPRGLPLMGN----------AHQMGKN 51
            :||...|:|        |.::.|...|..:.|.|  |:|.....|||:          ||.:   
plant    10 VFLIGFLILILNWVWRAVNWVWLRPKRLEKYLKKQGFSGNSYRILMGDMRESNQMDQVAHSL--- 71

  Fly    52 P----SEILDTVFSWWH----QYGKDNFVFWIGTYSNVLVTSSKYLEFILSSQTLITKSDIYQLT 108
            |    ::.|..:..:.|    ::||..|. |.|.|.||:|...:.|..|:|...|..|..|....
plant    72 PLPLDADFLPRMMPFLHHTVLKHGKKCFT-WYGPYPNVIVMDPETLREIMSKHELFPKPKIGSHN 135

  Fly   109 HPWLGLGLLTSTGSKWHKHRKMITPAFHFNILQDFHEVMNENSTKFIKHLKTVAA--GDNIFDFQ 171
            |.:|. |||...|.||.|||.::.|||..:.|:......|.:..:.::..:.:|:  |....|..
plant   136 HVFLS-GLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLEEWERLASAKGTMELDSW 199

  Fly   172 EQAHYLTLDVICDTAMGVS 190
            ...|.||.:::...:.|.|
plant   200 THCHDLTRNMLARASFGDS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e2NP_001286196.1 p450 35..469 CDD:278495 48/176 (27%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.