DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e2 and AT5G51900

DIOPT Version :9

Sequence 1:NP_001286196.1 Gene:Cyp4e2 / 35822 FlyBaseID:FBgn0014469 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_200003.1 Gene:AT5G51900 / 835265 AraportID:AT5G51900 Length:242 Species:Arabidopsis thaliana


Alignment Length:286 Identity:58/286 - (20%)
Similarity:103/286 - (36%) Gaps:96/286 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 IIAKRIEAHKSGAVSTNAGDEFTRKKMA-------FLDTLLSSTIDGRPLNSKELYEEVSTFMFE 307
            |.|:|.|..:|   ..|..|.|.|...|       .|||.....:|  |:|.|.|.:.|...:..
plant    40 ISARREEVKRS---QVNNNDHFIRDSHANLLTSHIKLDTTQYQLLD--PINDKFLRDNVFALLLA 99

  Fly   308 GHDTTTSGVSFAVYLLSRHQDEQRKLFKEQREVMGNSELGRDATFQE---ISQMKYLDLFIKEAQ 369
            |.|||.|.:::..:.||   :....:.|.::|:  :..|.|..:.||   ...|:||:       
plant   100 GRDTTASALTWFFWFLS---ENPLVVTKIRQEI--DMNLPRSCSGQERPSCDPMEYLN------- 152

  Fly   370 RVYPSVPFIGRFTEKDYVIDGDLVPKGTTLNLGLVMLGYNEKVFKDPHKFRPERFELEKPGPFEY 434
                          ||         ..:.:....:.:...|..|:|                 ..
plant   153 --------------KD---------DESCMGRRCIRIQAREMDFRD-----------------RR 177

  Fly   435 VPFSAGPRNCIGQKFALLEIKTVVSKIIRNFEVLPALDELVSKDGYISTTIGLPDAERKKRDPYR 499
            |......|.|.|::.|::::|.|..:|::|:::..|..:                          
plant   178 VSIQCRSRICHGKQRAMVQMKIVAVEILQNYDIKVANGQ-------------------------- 216

  Fly   500 HKYDPILSAVLTLKSENGLYIRLKER 525
             |::|..|  |.||.::|..:::.:|
plant   217 -KFEPDTS--LILKMKHGFKVKINKR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e2NP_001286196.1 p450 35..469 CDD:278495 49/228 (21%)
AT5G51900NP_200003.1 p450 <2..239 CDD:299894 57/284 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.