DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e2 and CYP702A6

DIOPT Version :9

Sequence 1:NP_001286196.1 Gene:Cyp4e2 / 35822 FlyBaseID:FBgn0014469 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_680696.2 Gene:CYP702A6 / 827207 AraportID:AT4G15396 Length:475 Species:Arabidopsis thaliana


Alignment Length:508 Identity:104/508 - (20%)
Similarity:195/508 - (38%) Gaps:119/508 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LYIFLALPL-LLVAYLELSTFRRRRVLNKFN-----GPRGLPLMGNA------HQMGKNPSEILD 57
            ||.|.|:.: |:|..|..|.::.|.  .|.|     |..|.|::|..      |...:.|:.:.:
plant     4 LYEFWAVIVSLIVVKLCHSIYQWRN--PKSNGELPPGSMGYPIIGETFEFMKPHDAIQLPTFVKE 66

  Fly    58 TVFSWWHQYGKDNFVFWIGTYSNVLVTSS------------------KYLEFILSSQTLITKSDI 104
            .|.    ::|.   ||....:...::.|:                  |.|..:..:..|....|.
plant    67 KVL----RHGP---VFRTSLFGGKVIISTDIGLNMEIAKTNHIPGMPKSLARLFGANNLFVNKDT 124

  Fly   105 YQLTHPWLGLGLLTSTGSKWHKHRKMIT------PAFHFNILQDFHEVMNENSTKFIKHLKTVAA 163
                                |||.:.:|      .|....:|||...::.       .|||..|.
plant   125 --------------------HKHARSLTNQFLGSQALKLRMLQDIDFLVR-------THLKEGAR 162

  Fly   164 GDNIFDFQEQAHYLTLDVICDTAMGVSINAMENRSSSIVQAFKD--MCYNINMRAFHPLKRN--- 223
            ..:: |.:|....:.::.:....||    .||      ..|.|:  :|:....|.:.....|   
plant   163 KGSL-DIKETTSKIIIECLAKKVMG----EME------PDAAKELTLCWTFFPREWFGFAWNIPG 216

  Fly   224 ELLYRLAPDYPAYSRTLKTLQDFTNEIIAKRIEAHKSGAVSTNAGDEFTRKKMAFLDTLLSSTID 288
            ..:||:.   .|.:|.:|.|::   .::.||       |.....||        |..|:...|..
plant   217 TGVYRMV---KARNRMMKVLKE---TVLKKR-------ASGEELGD--------FFKTIFGDTER 260

  Fly   289 G-RPLNSKELYEEVSTFMFEGHDTTTSGVSFAVYLLSRHQDEQRKLFKEQ----REVMGNSELGR 348
            | :.::.:...|.:.|.....::||.:.::..:.|:|.|....::|.:|.    |:.:..:|.. 
plant   261 GVKTISLESATEYIFTLFLLANETTPAVLAATIKLISDHPKVMQELQREHEGIVRDKIEKNEKA- 324

  Fly   349 DATFQEISQMKYLDLFIKEAQRVYPSVPFIGRFTEKDYVIDGDLVPKGTTLNLGLVMLGYNEKVF 413
            |.|:::...|.:..:.|.|:.|:..:||.:.|..:.::......:|.| .:.:|...:.:|.:.:
plant   325 DLTWEDYKSMTFTQMVINESLRITSTVPTVLRIIDHEFQFGEYTIPAG-WIFMGYPYVHFNAEKY 388

  Fly   414 KDPHKFRPERF---ELEKPGPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIR 463
            .||..|.|.|:   :|.......|:||.:|.|.|:|.:|..|::...:..:.|
plant   389 DDPLAFNPWRWKGKDLSAIVSRTYIPFGSGSRLCVGAEFVKLKMAIFIHHLSR 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e2NP_001286196.1 p450 35..469 CDD:278495 93/472 (20%)
CYP702A6NP_680696.2 p450 9..454 CDD:299894 101/503 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.