DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e2 and CYP83A1

DIOPT Version :9

Sequence 1:NP_001286196.1 Gene:Cyp4e2 / 35822 FlyBaseID:FBgn0014469 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_193113.1 Gene:CYP83A1 / 827011 AraportID:AT4G13770 Length:502 Species:Arabidopsis thaliana


Alignment Length:495 Identity:120/495 - (24%)
Similarity:197/495 - (39%) Gaps:70/495 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IFLALPLLLVAYLELSTFRRRRVLNKFNGPRGLPLMGNAHQMGK-NPSEILDTVFSWWHQYGKDN 70
            :.||..||...|.:..|.|.:..    .||..||::||..|:.| ||....   ..|..:|| ..
plant     9 VALAAVLLFFLYQKPKTKRYKLP----PGPSPLPVIGNLLQLQKLNPQRFF---AGWAKKYG-PI 65

  Fly    71 FVFWIGTYSNVLVTSSKYLEFILSSQTLITKSDIYQLTHPWLGLG----LLTSTGSKWHKHRKM- 130
            ..:.||:.:.|:::|::..:.:|.:|.:..........|.::..|    .|......:.:.||| 
plant    66 LSYRIGSRTMVVISSAELAKELLKTQDVNFADRPPHRGHEFISYGRRDMALNHYTPYYREIRKMG 130

  Fly   131 ITPAFHFNILQDFHEVMNENSTKFIKHLKTVAAGDNIFDFQEQAHYLTLDVICDTAMGVSIN--- 192
            :...|....:..|..|..|.:.:.:..:...|....:.|..|.....|..|:|..|.|...|   
plant   131 MNHLFSPTRVATFKHVREEEARRMMDKINKAADKSEVVDISELMLTFTNSVVCRQAFGKKYNEDG 195

  Fly   193 AMENRSSSIVQAFKDMCYNINMRAFHPL--KRNELLYRLAPDYPAYSRTLKTLQDFTNEII-AKR 254
            ....|...|:...:.:...|....|.|.  ..::|....|.....:.|....:|:..||.: .||
plant   196 EEMKRFIKILYGTQSVLGKIFFSDFFPYCGFLDDLSGLTAYMKECFERQDTYIQEVVNETLDPKR 260

  Fly   255 IEAHKSGAVSTNAG--------DEFT--RKKMAFLDTLLSSTIDGRPLNSKELYEEVSTFMFEGH 309
            ::......:....|        .|||  ..|...||.:::.|                       
plant   261 VKPETESMIDLLMGIYKEQPFASEFTVDNVKAVILDIVVAGT----------------------- 302

  Fly   310 DTTTSGVSFAVYLLSRHQDEQRKLFKEQREVMGNSELGRDATF---QEISQMKYLDLFIKEAQRV 371
            ||..:.|.:.:..|.::....:|...|.||.|  .|.|  :||   .::..:.|....:||..|:
plant   303 DTAAAAVVWGMTYLMKYPQVLKKAQAEVREYM--KEKG--STFVTEDDVKNLPYFRALVKETLRI 363

  Fly   372 YPSVP-FIGRFTEKDYVIDGDLVPKGTTLNLGLVMLGYNEKVF-KDPHKFRPERFELEKPGPF-- 432
            .|.:| .|.|...:|..|.|..:|.|||:|:....:..:||.: .:|.:|||||| |||...|  
plant   364 EPVIPLLIPRACIQDTKIAGYDIPAGTTVNVNAWAVSRDEKEWGPNPDEFRPERF-LEKEVDFKG 427

  Fly   433 ---EYVPFSAGPRNCIGQKF--ALLEIKTVVSKIIRNFEV 467
               |::||.:|.|.|.|.:.  |:||:......:..||::
plant   428 TDYEFIPFGSGRRMCPGMRLGAAMLEVPYANLLLSFNFKL 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e2NP_001286196.1 p450 35..469 CDD:278495 113/467 (24%)
CYP83A1NP_193113.1 PLN02966 1..502 CDD:178550 120/495 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.