DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e2 and AT3G44970

DIOPT Version :9

Sequence 1:NP_001286196.1 Gene:Cyp4e2 / 35822 FlyBaseID:FBgn0014469 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_190083.2 Gene:AT3G44970 / 823632 AraportID:AT3G44970 Length:479 Species:Arabidopsis thaliana


Alignment Length:478 Identity:100/478 - (20%)
Similarity:179/478 - (37%) Gaps:112/478 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 ILDTVFSWWHQYG--KDN------------------FVFWIGTYSNVLVTSSKYLEF-------I 92
            ::..|..||:|:.  |.|                  |....|.|........|.|.:       |
plant    15 VVARVGHWWYQWSNPKSNGKLPPGSMGFPIIGETLDFFKPYGFYEISPYLKKKMLRYGPLFRTNI 79

  Fly    93 LSSQTLI-TKSDI-----------YQLTHPWLGLGLLTSTG--------SKWHKHRKMITPAFHF 137
            |..:|:: |..|:           :.|::|   .||:...|        ...|||.|.||  .|.
plant    80 LGVKTVVSTDKDVNMEILRQENKSFILSYP---DGLMKPLGKDSLFLKIGNIHKHIKQIT--LHL 139

  Fly   138 --------NILQDFHEVMNENSTKFIKHLKTVAAGDNIFDFQEQAHYLTLDVICDTAMGVSINAM 194
                    .||:|...|..|       ||.:.|....: |.::....|   :|......:..|..
plant   140 LSSEGLKRKILKDMDRVTRE-------HLSSKAKTGRL-DVKDAVSKL---IIAHLTPKMMSNLK 193

  Fly   195 ENRSSSIVQAFKDMCYNINMRAFHPLKRNELLYRLAPDYPAYSRTLKTLQDFTNEIIAKRIEAHK 259
            ....:.::..||...::. .|..:.:...:.||          .||...::...||         
plant   194 PQTQAKLMGIFKAFTFDW-FRTSYLISAGKGLY----------NTLWACREGMREI--------- 238

  Fly   260 SGAVSTNAGDEFTRKKMA------FLDTLL-SSTIDGRPLNSKELYEEVSTFMFEGHDTTTSGVS 317
                    .|.:|.:|.:      ||:|.: .|...|..||...:...:.|......|||:..:.
plant   239 --------KDIYTMRKTSEEKYDDFLNTAIEESEKAGELLNENAIITLIFTLSCVTQDTTSKAIC 295

  Fly   318 FAVYLLSRHQDEQRKLFKEQREVMGNSELGRD--ATFQEI-SQMKYLDLFIKEAQRVYPSVPFIG 379
            .||..|..:.....:| |::.||:..|...::  .|::|. .:|.:.::.|.|:.|:....|.:.
plant   296 LAVKFLLENPKVLAEL-KKEHEVILESREDKEGGVTWEEYRHKMTFTNMVINESLRITNLAPMLF 359

  Fly   380 RFTEKDYVIDGDLVPKGTTLNLGLVMLGYNEKVFKDPHKFRPERFELE--KPGPFEYVPFSAGPR 442
            |...||..|.|..:|.|..:.:...::.::.:::::|.:|.|.|:|.:  :.|...::.|..|.|
plant   360 RKAVKDVEIKGYTIPAGWIVMIIPSVVHFDPEIYENPFEFNPWRWEGKELRAGSKTFMVFGTGLR 424

  Fly   443 NCIGQKFALLEIKTVVSKIIRNF 465
            .|.|.:||.|:|...:..::..:
plant   425 QCAGAEFARLQISVFLHHLVTTY 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e2NP_001286196.1 p450 35..469 CDD:278495 100/478 (21%)
AT3G44970NP_190083.2 p450 34..475 CDD:299894 94/459 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.