DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e2 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_001286196.1 Gene:Cyp4e2 / 35822 FlyBaseID:FBgn0014469 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001003947.1 Gene:Cyp4x1 / 81906 MGIID:1932403 Length:507 Species:Mus musculus


Alignment Length:536 Identity:153/536 - (28%)
Similarity:260/536 - (48%) Gaps:64/536 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LYIFLALPLLLVAYLELSTFRRR--RVLNKFNGPRGLPLMGNAHQMGKNPSEILDTVFSWWHQYG 67
            |.:...|.|:|:..::|...|:|  |.|:.|.||....|:|:...:.::..|.||.:.. .|...
Mouse    16 LALVFCLALVLMQAMKLYLRRQRLLRDLSPFPGPPAHWLLGHQKFLQEDNMETLDEIVK-KHPCA 79

  Fly    68 KDNFVFWIGTYSNVL-VTSSKYLEFILSSQTLITKSD-----IYQLTHPWLGLGLLTSTGSKWHK 126
               |..|:|.:.... :....|.:..||      ::|     ::||..|.:|.|||...|.:|.:
Mouse    80 ---FPCWVGPFQAFFYIYDPDYAKIFLS------RTDPKMQYLHQLLTPCIGRGLLNLDGPRWFQ 135

  Fly   127 HRKMITPAFHFNILQDFHEVMNENSTKFI--KHLKTVAAGDNIFDFQEQAHYLTLDVICDTAMGV 189
            ||.::|||||.:||:...:.| .:|.|.:  |..|.....:...:..|..:.:|||:|...|.|.
Mouse   136 HRCLLTPAFHQDILKPCVDTM-AHSVKVMLDKWEKMWTTQETTIEVFEHINLMTLDIIMKCAFGQ 199

  Fly   190 SINAMENRS-SSIVQAFKDMCYNINMRAFHPLKRNELLYRLAPDYPAYSRTLKTLQDFTNEIIAK 253
            ..|...|.: .|.|:|..::...|:.|.::....::::::|:|....:....|.:..:|.:||..
Mouse   200 ETNCQINGTYESYVKATFELGEIISSRLYNFWHHHDIIFKLSPKGHCFQELGKVIHQYTEKIIQD 264

  Fly   254 RIEAHKSGAVSTNAGDEFTRKKMAFLDTLLSSTI-DGRPLNSKELYEEVSTFMFEGHDTTTSGVS 317
            |.:..|:     ....:.|:....|||.:||:.. |.|..:..:|..||:|||:.|||.:.:.:|
Mouse   265 RKKILKN-----QVKQDDTQTSQIFLDIVLSAQAEDERAFSDADLRAEVNTFMWAGHDASAASIS 324

  Fly   318 FAVYLLSRHQDEQRKLFKEQREVMGNSELGRDATFQEISQMKYLDLFIKEAQRVYPSVPFIGRFT 382
            :.:|.|:.:.:.|.:...|.|.::|:   |...|::::.:|.|..:.|||..|:.|.||.|.|..
Mouse   325 WLLYCLALNPEHQDRCRTEIRSILGD---GSSITWEQLDEMSYTTMCIKETLRLIPPVPSISREL 386

  Fly   383 EKDYVI-DGDLVPKGTTLNLGLVMLGYNEKVFKDPHKFRPERFELEKPG---PFEYVPFSAGPRN 443
            .|...: ||..:|.|.|:.|.:..|.:|..|:.||..|.|.||..|...   |..::|||:||||
Mouse   387 SKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWNDPKVFDPLRFTKENSDQRHPCAFLPFSSGPRN 451

  Fly   444 CIGQKFALLEIKTVVSKIIRNFEVLPALDELVSKDGYISTTIGLPDAERKKRDPYRHKYDPILSA 508
            ||||:||:||:|..::.|:.:|:|.|.|..                             .|..|:
Mouse   452 CIGQQFAMLELKVAIALILLHFQVAPDLTR-----------------------------PPAFSS 487

  Fly   509 VLTLKSENGLYIRLKE 524
            ...|:.::|:|:.||:
Mouse   488 HTVLRPKHGIYLHLKK 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e2NP_001286196.1 p450 35..469 CDD:278495 134/447 (30%)
Cyp4x1NP_001003947.1 p450 47..499 CDD:278495 140/499 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845100
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.