DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e2 and CYP94C1

DIOPT Version :9

Sequence 1:NP_001286196.1 Gene:Cyp4e2 / 35822 FlyBaseID:FBgn0014469 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_180337.1 Gene:CYP94C1 / 817315 AraportID:AT2G27690 Length:495 Species:Arabidopsis thaliana


Alignment Length:506 Identity:120/506 - (23%)
Similarity:208/506 - (41%) Gaps:122/506 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NPSEILDTVFSWWHQYGKDNFVFWIGTYSNVLVTSSKYLEFILSSQTLITKSDIYQLTHPWLGLG 115
            |||.:...:.:.:|.|.|                 .|....||        .|:       ||.|
plant    80 NPSNVEHILKTNFHNYPK-----------------GKQFSVIL--------GDL-------LGRG 112

  Fly   116 LLTSTGSKWHKHRKMITPAFHFNILQDF-HEVM-NENSTKFIKHLKTVAAGDN---IFDFQEQAH 175
            :..|.|..|...||:.:.......::.| ||:: .|..|:.:..|.:.:  ||   :.|.|:...
plant   113 IFNSDGDTWRFQRKLASLELGSVSVRVFAHEIVKTEIETRLLPILTSFS--DNPGSVLDLQDVFR 175

  Fly   176 YLTLDVICDTAMG-----------VSINAMENRSSSIVQAFKDMCYNINMRAFHP---LKRNELL 226
            ..:.|.|...:.|           :|..|:...::|::.|         .||..|   |.:.:.|
plant   176 RFSFDTISKLSFGFDPDCLRLPFPISEFAVAFDTASLLSA---------KRALAPFPLLWKTKRL 231

  Fly   227 YRLAPDYPAYSRTLKTLQDFTNEIIAKRIEAHKSGAVSTNAGDEFTRKKMAFL---DTLLSSTID 288
            .|:..:        |.||:..|             .::..|||...::::..|   :.|:|..:.
plant   232 LRIGSE--------KKLQESIN-------------VINRLAGDLIKQRRLTGLMGKNDLISRFMA 275

  Fly   289 GRPLNSKE-LYEEVSTFMFEGHDTTTSGVSFAVYLLSRHQDEQRKLFKEQREVMGNSELGRDATF 352
            ....:..| |.:.|.:|:..|.||..:|::...:||:||.:.:.::.:|...|||.......|..
plant   276 VVAEDDDEYLRDIVVSFLLAGRDTVAAGLTGFFWLLTRHPEVENRIREELDRVMGTGFDSVTARC 340

  Fly   353 QEISQMKYLDLFIKEAQRVYPSVPFIGRFTEKDYVI-DGDLVPKGTTLNLGLVMLGYNEKVF-KD 415
            .|:.:|.||...:.|:.|::|.|.|..:|...|.|: ||..|..||.:......:|..:::: .|
plant   341 DEMREMDYLHASLYESMRLFPPVQFDSKFALNDDVLSDGTFVNSGTRVTYHAYAMGRMDRIWGPD 405

  Fly   416 PHKFRPERFELEKPG------PFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFEVLPALDEL 474
            ..:|:|||: |:..|      |.:|..|.||.|.|||::.|::|:|::...|||.||        
plant   406 YEEFKPERW-LDNEGKFRPENPVKYPVFQAGARVCIGKEMAIMEMKSIAVAIIRRFE-------- 461

  Fly   475 VSKDGYISTTIGLPDAERKKRDPYRHKYDPILSAVLTLKSENGLYIRLKER 525
                    |.:..|:.....|      :.|.|:|.:    ..||.:.::||
plant   462 --------TRVASPETTETLR------FAPGLTATV----NGGLPVMIQER 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e2NP_001286196.1 p450 35..469 CDD:278495 110/448 (25%)
CYP94C1NP_180337.1 PLN02426 23..495 CDD:215235 120/506 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8393
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.