DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e2 and Cyp3a71-ps

DIOPT Version :9

Sequence 1:NP_001286196.1 Gene:Cyp4e2 / 35822 FlyBaseID:FBgn0014469 Length:526 Species:Drosophila melanogaster
Sequence 2:XP_008767252.2 Gene:Cyp3a71-ps / 690383 RGDID:1597309 Length:183 Species:Rattus norvegicus


Alignment Length:178 Identity:32/178 - (17%)
Similarity:69/178 - (38%) Gaps:41/178 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 FNILQDFHEVMNENSTKFIKHLKTVAAGDNIFDFQEQAHYLTLDVICDTAMGVSINAMENRSSSI 201
            |.|::.:.:::       :|:|:..|........::.....::|||..|:.||:::::.|.....
  Rat    11 FPIIKLYGDIL-------VKYLRQEAEKGKPVSVKDIFGAYSMDVITSTSFGVNVDSLNNPKDPF 68

  Fly   202 VQAFKDMCYNINMRAFHPLKRNELLYRLAPDYPAYSRTLKTLQDFTNEIIAKRIEAHKSGAVSTN 266
            |:..|..   :.:..|.||..:..|:..          ||.:.|..|..:               
  Rat    69 VEKTKKF---LRLDYFDPLFISVELFPF----------LKPIYDMLNISV--------------- 105

  Fly   267 AGDEFTRKKMAFLDTLLSSTIDGRPLNSKELYE-EVSTFMFEGHDTTT 313
                |.:..:||....:.|..:.. |:||:.|: :....|...|:.::
  Rat   106 ----FPKDSIAFFKNFVYSMKESH-LDSKQKYQVDFFQLMMNAHNNSS 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e2NP_001286196.1 p450 35..469 CDD:278495 32/178 (18%)
Cyp3a71-psXP_008767252.2 cytochrome_P450 2..>153 CDD:425388 32/178 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.