DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e2 and CYP4F3

DIOPT Version :9

Sequence 1:NP_001286196.1 Gene:Cyp4e2 / 35822 FlyBaseID:FBgn0014469 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens


Alignment Length:471 Identity:147/471 - (31%)
Similarity:241/471 - (51%) Gaps:55/471 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 DNFVFWIGTYSNVL-VTSSKYLEFILSSQTLITKSD--IYQLTHPWLGLGLLTSTGSKWHKHRKM 130
            |...:|:|.:..:: :....|::.:|.:...|...|  .|....||||.|||.|.|.||.:||:|
Human    86 DMCCWWVGPWHAIVRIFHPTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRRM 150

  Fly   131 ITPAFHFNILQDFHEVMNENSTKFIKHLK---TVAAGDNIFDFQEQAHYLTLDVICDTAMGVSIN 192
            :|||||||||:.:.::.||:..  |.|.|   ..:.|....|..|....:|||.:.........:
Human   151 LTPAFHFNILKPYMKIFNESVN--IMHAKWQLLASEGSARLDMFEHISLMTLDSLQKCVFSFDSH 213

  Fly   193 AMENRSSSIVQAFKDMCYNINMRAFHPLKRNELLYRLAPDYPAYSRTLKTLQDFTNEIIAKRIEA 257
            ..| :.|..:.|..::...:..|....|...:.||.|.||...:.|..:.:.|||:.:|.:|...
Human   214 CQE-KPSEYIAAILELSALVTKRHQQILLYIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRT 277

  Fly   258 HKSGAVSTNAGDEFTR-----KKMAFLDT-LLSSTIDGRPLNSKELYEEVSTFMFEGHDTTTSGV 316
            ..|..|     |:|.:     |.:.|:|. |||...||:.|:.:::..|..||||||||||.||:
Human   278 LPSQGV-----DDFLQAKAKSKTLDFIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGL 337

  Fly   317 SFAVYLLSRHQDEQRKLFKEQREVMGNSELGRDATFQEISQMKYLDLFIKEAQRVYPSVPFIGRF 381
            |:.:|.|::|.:.|.:..:|.:|::.:.| .::..:.:::|:.:|.:.|||:.|::|.||.:.|.
Human   338 SWVLYHLAKHPEYQERCRQEVQELLKDRE-PKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRC 401

  Fly   382 TEKDYVI-DGDLVPKGTTLNLGLVMLGYNEKVFKDPHKFRPERFE---LEKPGPFEYVPFSAGPR 442
            ..:|.|: ||.::|||....:.:....:|..|:.||..:.|.||:   :::..|..::|||||||
Human   402 CTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPEVYDPFRFDPKNIKERSPLAFIPFSAGPR 466

  Fly   443 NCIGQKFALLEIKTVVSKIIRNFEVLPALDELVSKDGYISTTIGLPDAERKKRDPYRHKYDPILS 507
            |||||.||:.|:|.|:...:..|.|                   |||....:|.|          
Human   467 NCIGQAFAMAEMKVVLGLTLLRFRV-------------------LPDHTEPRRKP---------- 502

  Fly   508 AVLTLKSENGLYIRLK 523
             .|.|::|.||::|::
Human   503 -ELVLRAEGGLWLRVE 517

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e2NP_001286196.1 p450 35..469 CDD:278495 136/415 (33%)
CYP4F3NP_000887.2 p450 52..515 CDD:365848 146/467 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154791
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.