DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e2 and Cyp6t3

DIOPT Version :9

Sequence 1:NP_001286196.1 Gene:Cyp4e2 / 35822 FlyBaseID:FBgn0014469 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster


Alignment Length:443 Identity:95/443 - (21%)
Similarity:175/443 - (39%) Gaps:97/443 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 LGLLTSTGSK---WHKHRKMITPAFHFNILQD-FHEVMNENSTKFIKHLKTVAAGD---NIFDFQ 171
            :|.||...:|   |.:.|:.::..|....::| .:..|.:.::...::|.. ..||   .:....
  Fly   115 MGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYSQMLDVASDLEQYLNR-KLGDRLERVLPLG 178

  Fly   172 EQAHYLTLDVICDTAMGVSINAMENRSSSIVQAFKDMCYNINMRA--------FHPLKRNELLYR 228
            ......|.||..:....:::..:....|.::...|:: :|.|.|.        |.|.....|..:
  Fly   179 RMCQLYTTDVTGNLFYSLNVGGLRRGRSELITKTKEL-FNTNPRKVLDFMSVFFLPKWTGVLKPK 242

  Fly   229 L-APDYPAYSRTL------KTLQDFTNEIIAKRIEAHKSGAVSTNAGDEFTRKKMAFLDTLLSST 286
            : ..||..|.|.|      .|..|..|::      .|...:.|:|...:..       |.:.|  
  Fly   243 VFTEDYARYMRHLVDDHHEPTKGDLINQL------QHFQLSRSSNHYSQHP-------DFVAS-- 292

  Fly   287 IDGRPLNSKELYEEVSTFMFEGHDTTTSGVSFAVYLLSRHQDEQRKLFKEQREV-MGNSELGRDA 350
                         :....:..|.:|:::.:.|.:|.|::..|.|.:|..|.||. :..:.|..|.
  Fly   293 -------------QAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAFISTATLSYDT 344

  Fly   351 TFQEISQMKYLDLFIKEAQRVYPSVPFIGR---------FTEKDYVIDGDLVPKGTTLNLGLVML 406
                :..:.||.:...||.|:||:..|:.|         |:.:.:|  ..:||.|....:.::.|
  Fly   345 ----LMTLPYLKMVCLEALRLYPAAAFVNRECTSSASEGFSLQPHV--DFIVPPGMPAYISILGL 403

  Fly   407 GYNEKVFKDPHKFRPERFELEKP---GPFEYVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFEVL 468
            ..:|:.:.:|..|.||||..|:.   .|..|:||.|||..|||.:..:|::|..:..|::.:.| 
  Fly   404 HRDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQYWV- 467

  Fly   469 PALDELVSKDGYISTTIGLPDAERKKRDPYRHKYDPILSAVLTLKSENGLYIR 521
                                  |..:|.....:::|   ....|:|||.:|:|
  Fly   468 ----------------------ETCERTVSEIRFNP---KSFMLESENEIYLR 495

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e2NP_001286196.1 p450 35..469 CDD:278495 86/389 (22%)
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 89/432 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.