DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e2 and Cyp46a1

DIOPT Version :9

Sequence 1:NP_001286196.1 Gene:Cyp4e2 / 35822 FlyBaseID:FBgn0014469 Length:526 Species:Drosophila melanogaster
Sequence 2:XP_006240610.1 Gene:Cyp46a1 / 362782 RGDID:1306605 Length:500 Species:Rattus norvegicus


Alignment Length:484 Identity:128/484 - (26%)
Similarity:219/484 - (45%) Gaps:67/484 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLVAYLELSTF--RRRRVLNKFNG-PRGLPLMGNAHQMGKNP---SEILDTVF-SWWHQYGKDNF 71
            :|:|:....||  |.|.......| ||...|:|:.....|..   ..:|..|| .|..:||.   
  Rat    12 VLLAFGLCCTFVHRARSRYEHIPGPPRPSFLLGHLPYFWKKDEACGRVLQDVFLDWAKKYGP--- 73

  Fly    72 VFWIGTY--SNVLVTSSKYLEFILSSQTLITKSDIYQLTHP-----WLGLGLLTSTG-SKWHKHR 128
            |..:..:  ::|:|||.:.::..|.|......|.:|:....     ..|.||::... .:|:|.|
  Rat    74 VVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRAIQTVFGERLFGQGLVSECDYGRWYKQR 138

  Fly   129 KMITPAFHFNILQDFHEVMNENSTKFIKHLKTVAAGDNIFDFQEQAHYLTLDVICDTAMGVSINA 193
            :::..||..:.|.......||.:.:.::.|:..|.|......|:.....|:|::...|.|:..:.
  Rat   139 RVMDLAFSRSSLVSLMGTFNEKAEQLMEILEAKADGQTPVSMQDMLTCATIDILAKAAFGMETSM 203

  Fly   194 MENRSSSIVQAFKDMCYNIN-----MRAFHPLKRNE---------LLYRLAPDYPAYSR-TLKTL 243
            :......:.||.|.|...|:     :..|.|.||.:         ||.::..|:....| .||..
  Rat   204 LLGAQKPLSQAVKVMLEGISASRNTLAKFMPGKRKQLREIRESIRLLRQVGKDWVQRRREALKRG 268

  Fly   244 QDFTNEIIAKRIEAHKSGAVSTNAGDEFTRKKMAFLDTLLSSTIDGRPLNSKELYEEVSTFMFEG 308
            :|...:|:.:.::|.:      .|.|:         :.||.:.:               ||...|
  Rat   269 EDVPADILTQILKAEE------GAQDD---------EVLLDNFV---------------TFFIAG 303

  Fly   309 HDTTTSGVSFAVYLLSRHQDEQRKLFKEQREVMGNSELGRDATFQEISQMKYLDLFIKEAQRVYP 373
            |:|:.:.::|.|..|||..:...:|..|..||:|:.   |...::::.:::||...:||:.|:||
  Rat   304 HETSANHLAFTVMELSRQPEIVARLQAEVDEVVGSK---RHLDYEDLGRLQYLSQVLKESLRLYP 365

  Fly   374 SVPFIGRFTEKDYVIDGDLVPKGTTLNLGLVMLGYNEKVFKDPHKFRPERFELEKPGP-FEYVPF 437
            ......|..|::.:|||..||..|.|.....::|..:..|:||..|.|:||....|.| |.|.||
  Rat   366 PAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPF 430

  Fly   438 SAGPRNCIGQKFALLEIKTVVSKIIRNFE 466
            |.|.|:||||:||.:|:|.|::|:::..|
  Rat   431 SLGHRSCIGQQFAQMEVKVVMAKLLQRLE 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e2NP_001286196.1 p450 35..469 CDD:278495 122/461 (26%)
Cyp46a1XP_006240610.1 p450 34..466 CDD:278495 122/462 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.