DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e2 and Cyp9b1

DIOPT Version :9

Sequence 1:NP_001286196.1 Gene:Cyp4e2 / 35822 FlyBaseID:FBgn0014469 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_523645.1 Gene:Cyp9b1 / 35634 FlyBaseID:FBgn0015038 Length:505 Species:Drosophila melanogaster


Alignment Length:359 Identity:93/359 - (25%)
Similarity:171/359 - (47%) Gaps:28/359 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 WHKHRKMITPAFHFNILQDFHEVMNENSTKFIKHLKT---VAAGDNIF--DFQEQAHYLTLDVIC 183
            |...|.::||.|....:::...:|||:..:.::|||:   :|||:|.|  |.:...:.|:.|||.
  Fly   127 WRNMRSVLTPVFTSAKMRNMFTLMNESFAQCLEHLKSSQPIAAGENAFELDMKVLCNKLSNDVIA 191

  Fly   184 DTAMGVSINAMENRSSSIVQAFKDMCYNINMRAFHPLKRNELLYRLAPDYPAYSRTLKTLQDFTN 248
            .||.|:.:|:.::..:......|.:.::   |....||  .::..|||  ..::....|:.|.||
  Fly   192 TTAFGLKVNSFDDPENEFHTIGKTLAFS---RGLPFLK--FMMCLLAP--KVFNFFKLTIFDSTN 249

  Fly   249 EIIAKRIEAHKSGAVSTNAGDEFTRKKMAFLDTLLSSTIDGRP-LNSKELYEEVSTFMFEGHDTT 312
            .....|:..   .|:........||..|  :..|:.:..:.:. ....|:..:...|.|...:..
  Fly   250 VEYFVRLVV---DAMQYREKHNITRPDM--IQLLMEAKKESKDNWTDDEIVAQCFIFFFAAFENN 309

  Fly   313 TSGVSFAVYLLSRHQDEQRKLFKEQREVMGNSELGRDATFQEISQMKYLDLFIKEAQRVYPSVPF 377
            ::.:....|.|.|:.|.|.:|::|.:|.. .:..|...|:....:|.|:|:.|.|:.|.:.....
  Fly   310 SNLICTTAYELLRNLDIQERLYEEVKETQ-EALKGAPLTYDAAQEMTYMDMVISESLRKWTLSAA 373

  Fly   378 IGRFTEKDYVIDGDLVPK------GTTLNLGLVMLGYNEKVFKDPHKFRPERF-ELEKPG--PFE 433
            ..|...|||.:..|...|      |..:|:.:..|.::|:.|..|.:|.|||| |..|..  |:.
  Fly   374 ADRLCAKDYTLTDDEGTKLFEFKAGDNINIPICGLHWDERFFPQPQRFDPERFSERRKKDLIPYT 438

  Fly   434 YVPFSAGPRNCIGQKFALLEIKTVVSKIIRNFEV 467
            |:||..|||:|||.::|:::.|.::..::.|:::
  Fly   439 YLPFGVGPRSCIGNRYAVMQAKGMLYNLMLNYKI 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e2NP_001286196.1 p450 35..469 CDD:278495 93/359 (26%)
Cyp9b1NP_523645.1 p450 37..478 CDD:299894 93/359 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.