DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4e2 and cyp-31A5

DIOPT Version :9

Sequence 1:NP_001286196.1 Gene:Cyp4e2 / 35822 FlyBaseID:FBgn0014469 Length:526 Species:Drosophila melanogaster
Sequence 2:NP_001343697.1 Gene:cyp-31A5 / 13198891 WormBaseID:WBGene00013381 Length:308 Species:Caenorhabditis elegans


Alignment Length:258 Identity:81/258 - (31%)
Similarity:128/258 - (49%) Gaps:1/258 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWFVLYIFLALPLLLVAYLELSTFRRRRVLNKFNGPRGLPLMGNAHQMGKNPSEILDTVFSWWHQ 65
            |..::...|.....::|:|.....|.|:||...|.||..|::|:......:|...::.|....:.
 Worm     1 MGVIIPAVLLASATVIAWLIYKHLRMRQVLKHLNQPRSYPIVGHGLITKPDPEGFMNQVIGMGYL 65

  Fly    66 YGKDNF-VFWIGTYSNVLVTSSKYLEFILSSQTLITKSDIYQLTHPWLGLGLLTSTGSKWHKHRK 129
            |..... :.|||.:..:::.|:..:|.|.||...:.|...|.|..||||:.:|||...:|...||
 Worm    66 YPDPRMCLLWIGPFPCLMLYSADLVEPIFSSTKHLNKGFAYVLLEPWLGISILTSQKEQWRPKRK 130

  Fly   130 MITPAFHFNILQDFHEVMNENSTKFIKHLKTVAAGDNIFDFQEQAHYLTLDVICDTAMGVSINAM 194
            ::||.||::||:||..:.||.|...|:.|..:...|...|........|||:||:|:||.:|.|.
 Worm   131 LLTPTFHYDILKDFLPIFNEQSKILIQKLCCLGVADEEVDVLSVITLCTLDIICETSMGKAIGAQ 195

  Fly   195 ENRSSSIVQAFKDMCYNINMRAFHPLKRNELLYRLAPDYPAYSRTLKTLQDFTNEIIAKRIEA 257
            ...::..|.|...:...|:.|..:||..|..:|.|..|...:.:.|..|.|||.::|.:|.||
 Worm   196 LAENNEYVWAVHTINKLISKRTNNPLMWNSFIYNLTEDGRTHEKCLHILHDFTKKVIVERKEA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4e2NP_001286196.1 p450 35..469 CDD:278495 72/224 (32%)
cyp-31A5NP_001343697.1 p450 36..>261 CDD:325183 72/223 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163545
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.