DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and CYP735A2

DIOPT Version :9

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_176882.1 Gene:CYP735A2 / 843031 AraportID:AT1G67110 Length:512 Species:Arabidopsis thaliana


Alignment Length:553 Identity:128/553 - (23%)
Similarity:234/553 - (42%) Gaps:93/553 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FLIAIAIILATILVFKGV--------RIFNYIDHMAGIMEMIPGPTPYPFVGNLFQF-------- 50
            :::.|.:.|...:::..:        ||..:::...     |.||.|....||:...        
plant     9 YVLVIVMTLILRVLYDSICCYFLTPRRIKKFMERQG-----ITGPKPRLLTGNIIDISKMLSHSA 68

  Fly    51 ---------GLKPAEYPKKV---LQYCRKY-DFQGFRSLVFLQYHMMLSDPAEIQNILSSSSLLY 102
                     .:.|...|..|   .||.::: .:.|....:.|....|:.:.....|.::..|.|.
plant    69 SNDCSSIHHNIVPRLLPHYVSWSKQYGKRFIMWNGTEPRLCLTETEMIKELLTKHNPVTGKSWLQ 133

  Fly   103 KEHLYSFLRPWLGDGLLTSSGARWLKHQKLYAPAFERSAIEGYLRVVHRTGGQFVQKLDVLSDTQ 167
            ::....|    :|.|||.::|..|...:.:.||||.|..::||.:.:........::|  ..:..
plant   134 QQGTKGF----IGRGLLMANGEAWHHQRHMAAPAFTRDRLKGYAKHMVECTKMMAERL--RKEVG 192

  Fly   168 EVFDAQELVAKCTLDIVCENATGQDSSSLNGETSDLHGAIKDLCDVVQERTFSIVKRFDALFRLT 232
            |..:..|.:.:.|.||:.....| .|.....|...|...::.||............||     |.
plant   193 EEVEIGEEMRRLTADIISRTEFG-SSCDKGKELFSLLTVLQRLCAQATRHLCFPGSRF-----LP 251

  Fly   233 SYYMKQRRALSLLRSELNR----IISQRRHQLAAENTCQQGQPINKPFLDVLLTAKLDGKV--LK 291
            |.|   .|.:..|::|:.|    ||..|:..:....:...|..:    |.:||. ::|...  |.
plant   252 SKY---NREIKSLKTEVERLLMEIIDSRKDSVEIGRSSSYGDDL----LGLLLN-QMDSNKNNLN 308

  Fly   292 EREIIEEVSTFIFTGHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIFGENFAGEADLARLDQMH 356
            .:.|::|..||.||||:..:..:::||..|:.:...|....:|.|::.|::  |...:.:|..:.
plant   309 VQMIMDECKTFFFTGHETTSLLLTWTLMLLAHNPTWQDNVRDEVRQVCGQD--GVPSVEQLSSLT 371

  Fly   357 YLELIIRETLRLYPSVPLIARTNRNPIDINGTKVAKCTTVIMCLIAMGY-NEKYFDDPCTFRPER 420
            .|..:|.|:|||||...|:.|.....|.:....:.|..::.:.::|:.: ||.:.:|...|.|||
plant   372 SLNKVINESLRLYPPATLLPRMAFEDIKLGDLIIPKGLSIWIPVLAIHHSNELWGEDANEFNPER 436

  Fly   421 FENPTGNVGIEAFKS----VPFSAGPRRCIAEKFAMYQMKALLSQLLRRFEILPAVDGLPPGIND 481
            |..       .:|.|    :||:||||.||.:.|||.:.|.:|:.|:.:|..         .|::
plant   437 FTT-------RSFASSRHFMPFAAGPRNCIGQTFAMMEAKIILAMLVSKFSF---------AISE 485

  Fly   482 HSREDCVPQSEYDPVLNIRVTLKSENGIQIRLR 514
            :.|        :.|:  :.:|:|.:.|:|:.|:
plant   486 NYR--------HAPI--VVLTIKPKYGVQLVLK 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 115/465 (25%)
CYP735A2NP_176882.1 PLN02290 2..511 CDD:215164 128/553 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 160 1.000 Domainoid score I1269
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.