DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and CYP96A14P

DIOPT Version :9

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_176777.1 Gene:CYP96A14P / 842916 AraportID:AT1G66030 Length:167 Species:Arabidopsis thaliana


Alignment Length:168 Identity:37/168 - (22%)
Similarity:65/168 - (38%) Gaps:43/168 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAIAIILATILVFKGVRIFNYIDHMAGIMEMIPGPTPYPFVGNLFQFGL----KPAEYPKKVLQY 64
            :|:..::...:.|....||.|.        :|..|..|..: .:.|.||    .....|..:::.
plant     1 MALIGLIEAFIAFVCFLIFYYF--------LIKKPYSYILI-KISQSGLWNWPVLGMSPGALMRL 56

  Fly    65 CRKYDFQGFRSLVFLQ-----YHMMLSDPAEIQNILSSSSLLYKEHLYSFLRPWL-------GDG 117
            .|.|||    |:..|:     :|......|.| :||:::..:...|:| :..|.|       |||
plant    57 PRIYDF----SVDLLENSNLTFHFKGPWFAGI-DILATADSVNINHIY-YRGPELREIFGPFGDG 115

  Fly   118 LLTSSGARW----------LKHQKL--YAPAFERSAIE 143
            ::.|....|          ..|||.  ::.:..||.::
plant   116 IINSDSELWRNLKKATQVIFNHQKYQKFSTSTTRSKLK 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 31/136 (23%)
CYP96A14PNP_176777.1 p450 1..>166 CDD:386267 37/168 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.