DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and CYP87A2

DIOPT Version :9

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001184974.1 Gene:CYP87A2 / 837830 AraportID:AT1G12740 Length:478 Species:Arabidopsis thaliana


Alignment Length:524 Identity:111/524 - (21%)
Similarity:187/524 - (35%) Gaps:123/524 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 PGPTPYPFVGNLFQFGLKP----------AEYPKKVLQYCR-----KYDFQGFRSLVF----LQY 81
            ||...:|.:|...|| .||          .|..|..:..||     |.:..|...:|.    |.|
plant    33 PGSMGFPLLGESIQF-FKPNKTSDIPPFIKERVKNDVDMCRYGPIFKTNLVGRPVIVSTDADLSY 96

  Fly    82 HMMLSD--------PAEIQNILSSSSLLYKEHLYSFLRPWLGDGLLTSSGARWLKHQKLYAPAFE 138
            .:...:        |....:|....::   ..|:.|:..:|.:.:||..|...||..   .|..|
plant    97 FVFNQEGRCFQSWYPDTFTHIFGKKNV---GSLHGFMYKYLKNMVLTLFGHDGLKKM---LPQVE 155

  Fly   139 RSAIEGYLRVVHRTGGQFVQKLDVLSDTQEVFDAQELVAKCTLDIVCENATGQD----SSSLNGE 199
            .:|               .::|::.|: |:..:.::..|....|:..:.....|    |.:|...
plant   156 MTA---------------NKRLELWSN-QDSVELKDATASMIFDLTAKKLISHDPDKSSENLRAN 204

  Fly   200 -TSDLHGAIKDLCDVVQERTFSIVKRFDALFRLTSYY---MKQRRALSLLRSELNRIISQRRHQL 260
             .:.:.|.|....|:..                |:|:   ..:.:|:.:||:    ::.:||   
plant   205 FVAFIQGLISFPFDIPG----------------TAYHKCLQGRAKAMKMLRN----MLQERR--- 246

  Fly   261 AAENTCQQGQPINKP--FLD-VLLTAKLDGKVLKEREIIEEVSTFIFTGHDPIAAAISFTLYTLS 322
              ||      |...|  |.| |:...:.:|.:|.|...::.:...:|...:..:.|::..:..||
plant   247 --EN------PRKNPSDFFDYVIEEIQKEGTILTEEIALDLMFVLLFASFETTSLALTLAIKFLS 303

  Fly   323 RHSEIQQKAAEEQRRIFGENFAGEADLA--RLDQMHYLELIIRETLRLYPSVPLIARTNRNPIDI 385
            ...|:.::..||...|.......::.|.  ....|.|....|.||.||...||.|.|.....|..
plant   304 DDPEVLKRLTEEHETILRNREDADSGLTWEEYKSMTYTFQFINETARLANIVPAIFRKALRDIKF 368

  Fly   386 NGTKVAKCTTVIMCLIAMGYNEKYFDDPCTFRPERFENPTGNVGIEAFKS-VPFSAGPRRCIAEK 449
            ....:.....|::|..|:..|.:.:.||..|.|.|:|   |:....|.|. :.|..|.|.|:...
plant   369 KDYTIPAGWAVMVCPPAVHLNPEMYKDPLVFNPSRWE---GSKVTNASKHFMAFGGGMRFCVGTD 430

  Fly   450 FAMYQMKALLSQLLRRFEILPAVDGLPPGINDHSREDCVPQSEYDPVLNIRVT--LKSENGIQIR 512
            |...||.|.|..|:.::.......|                       ||..|  |:..||..::
plant   431 FTKLQMAAFLHSLVTKYRWEEIKGG-----------------------NITRTPGLQFPNGYHVK 472

  Fly   513 LRKR 516
            |.|:
plant   473 LHKK 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 102/474 (22%)
CYP87A2NP_001184974.1 p450 4..475 CDD:299894 110/521 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.