DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and AT5G51900

DIOPT Version :9

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_200003.1 Gene:AT5G51900 / 835265 AraportID:AT5G51900 Length:242 Species:Arabidopsis thaliana


Alignment Length:300 Identity:57/300 - (19%)
Similarity:105/300 - (35%) Gaps:100/300 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 ALF-RLTSYYMKQRRALSLLRSELNR----IISQRRHQLAAE---NTCQQG--QPINKPFLDVLL 281
            |:| |:...|:..||. .:.||::|.    |.....:.|.:.   :|.|..  .|||..||.   
plant    30 AIFDRVCGKYISARRE-EVKRSQVNNNDHFIRDSHANLLTSHIKLDTTQYQLLDPINDKFLR--- 90

  Fly   282 TAKLDGKVLKEREIIEEVSTFIFTGHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIFGENFAGE 346
                           :.|...:..|.|..|:|:::..:.||.:..:..|..:|.......:.:|:
plant    91 ---------------DNVFALLLAGRDTTASALTWFFWFLSENPLVVTKIRQEIDMNLPRSCSGQ 140

  Fly   347 ADLARLDQMHYLELIIRETLRLYPSVPLIARTNRNPIDINGTKVAKCTTVIMCLIAMGYNEKYFD 411
             :....|.|.||                    |::.....|.:         | |.:...|..|.
plant   141 -ERPSCDPMEYL--------------------NKDDESCMGRR---------C-IRIQAREMDFR 174

  Fly   412 DPCTFRPERFENPTGNVGIEAFKSVPFSAGPRRCIAEKFAMYQMKALLSQLLRRFEILPAVDGLP 476
            |                     :.|......|.|..::.||.|||.:..::|:.::|..| :|  
plant   175 D---------------------RRVSIQCRSRICHGKQRAMVQMKIVAVEILQNYDIKVA-NG-- 215

  Fly   477 PGINDHSREDCVPQSEYDPVLNIRVTLKSENGIQIRLRKR 516
                          .:::|  :..:.||.::|.::::.||
plant   216 --------------QKFEP--DTSLILKMKHGFKVKINKR 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 49/252 (19%)
AT5G51900NP_200003.1 p450 <2..239 CDD:299894 55/298 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.