DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and CYP96A2

DIOPT Version :10

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_194944.1 Gene:CYP96A2 / 829349 AraportID:AT4G32170 Length:506 Species:Arabidopsis thaliana


Alignment Length:36 Identity:11/36 - (30%)
Similarity:15/36 - (41%) Gaps:0/36 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 TALASSTVAGFLTSVLMSPCDVVTTRMTNQAVSANG 244
            |.|.:|...|.|....:|||..:|.....:....||
plant    33 TCLCTSDFTGTLCETEVSPCTYMTCHNGGECEDHNG 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 CYP4 73..511 CDD:410721 11/36 (31%)
CYP96A2NP_194944.1 cytochrome_P450 1..503 CDD:477761 11/36 (31%)

Return to query results.
Submit another query.