DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and CYP72A9

DIOPT Version :9

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_188081.2 Gene:CYP72A9 / 820691 AraportID:AT3G14630 Length:563 Species:Arabidopsis thaliana


Alignment Length:523 Identity:125/523 - (23%)
Similarity:226/523 - (43%) Gaps:96/523 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAIAIILATILVFKGVRIFNYIDHMAGIMEM------IPGPTPYPFVGNLFQ-FGL------KPA 55
            |.||.:...::::...||..::.....::|.      :.|....|.||::.: |.:      ||.
plant    58 IVIASLALVVVLWCIWRILEWVWLKPKMLESYLRRQGLVGTRYTPLVGDVRRSFSMLKEARSKPM 122

  Fly    56 EYPKKVLQYCRKYDFQGFRSLVFLQYHMM------------------LSDPAEIQNILSSSSLLY 102
            :....::.....|.|           ||:                  :.:|..|:.:.:......
plant   123 KPTDDLISLVMPYSF-----------HMLNTYGKTFFTWSGPIPAITIMNPQLIKEVYNKFYDFE 176

  Fly   103 KEHLYSFLRPWLGDGLLTSSGARWLKHQKLYAPAFERSAIEGYLRVVHRTGGQFVQKLDVLSDTQ 167
            |.|.:. |...|.|||..:.|.:|:||:|:..|||....|:..:...:::      .::|:.:.:
plant   177 KTHTFP-LTSLLTDGLANADGDKWVKHRKIINPAFHFEKIKNMVPTFYKS------CIEVMCEWE 234

  Fly   168 EV---------FDAQELVAKCTLDIVCENATGQDSSSLNGETSDLHGAIKDLCDVVQERTFSIVK 223
            ::         .|....:...|.|::...|.|  ||...|:...:..|  :|..::   ..::.|
plant   235 KLVSDKGSSCELDVWPWIVNMTGDVISRTAFG--SSYKEGQRIFILQA--ELAHLI---ILALGK 292

  Fly   224 RFDALFRLTSYYMKQRRALSLLRSE----LNRIISQRRHQLAAENTCQQGQPINKPFLDVLLTAK 284
            .:...:|  .:..|..|.:..:..|    |..|||.|      |.....|:..:...|.:||.:.
plant   293 NYIPAYR--HFPTKNNRRMKTIVKEIQVILRGIISHR------EKARDAGEAPSDDLLGILLKSN 349

  Fly   285 LD---GKVLKEREIIEEVSTFIFTGHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIFGENFAGE 346
            .:   |..|...||:||...|.|.|.:..:..:::|:..||:|.:.|.:|.||..::||.|   :
plant   350 SEQSKGNGLNMEEIMEECKLFYFAGQETTSVLLAWTMVLLSQHQDWQARAREEVMQVFGHN---K 411

  Fly   347 ADLARLDQMHYLELIIRETLRLYPSVPLIARTNRNPIDINGTKVAKCTTVIMCLIAMGYNEKYF- 410
            .||..::|:..:.:||.|.|||||.|..:.|.....|.:....:.....|.|.::.:..:.|.: 
plant   412 PDLQGINQLKVMTMIIYEVLRLYPPVIQMNRATHKEIKLGDMTLPGGIQVHMPVLLIHRDTKLWG 476

  Fly   411 DDPCTFRPERFENPTGNVGI-EAFKS----VPFSAGPRRCIAEKFAMYQMKALLSQLLRR--FEI 468
            ||...|:||||::     || :|.|:    :||..|||.||.:.||:.:.|..|:.:|:|  ||:
plant   477 DDAAEFKPERFKD-----GIAKATKNQVCFLPFGWGPRICIGQNFALLEAKMALALILQRFSFEL 536

  Fly   469 LPA 471
            .|:
plant   537 SPS 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 118/482 (24%)
CYP72A9NP_188081.2 p450 59..563 CDD:386267 124/522 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.