DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and Cyp4x1

DIOPT Version :9

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001003947.1 Gene:Cyp4x1 / 81906 MGIID:1932403 Length:507 Species:Mus musculus


Alignment Length:538 Identity:144/538 - (26%)
Similarity:254/538 - (47%) Gaps:76/538 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAIAIILATILVFKGVRIFNYIDHMAGIMEMIPGPTPYPFVGN-----------LFQFGLK-PAE 56
            :|:...||.:|: :.::::.....:...:...|||..:..:|:           |.:...| |..
Mouse    16 LALVFCLALVLM-QAMKLYLRRQRLLRDLSPFPGPPAHWLLGHQKFLQEDNMETLDEIVKKHPCA 79

  Fly    57 YPKKVLQYCRKYDFQGFRSLVFLQYHMMLSDPAEIQNILSSSSLLYKEHLYSFLRPWLGDGLLTS 121
            :|      |....||.|    |..|     || :...|..|.:....::|:..|.|.:|.|||..
Mouse    80 FP------CWVGPFQAF----FYIY-----DP-DYAKIFLSRTDPKMQYLHQLLTPCIGRGLLNL 128

  Fly   122 SGARWLKHQKLYAPAFERSAIEGYLRVVHRTGGQFVQKLDVLSDTQ----EVFDAQELVAKCTLD 182
            .|.||.:|:.|..|||.:..::..:..:..:....:.|.:.:..||    |||:...|:   |||
Mouse   129 DGPRWFQHRCLLTPAFHQDILKPCVDTMAHSVKVMLDKWEKMWTTQETTIEVFEHINLM---TLD 190

  Fly   183 IVCENATGQDSS-SLNGETSDLHGAIKDLCDVVQERTFSIVKRFDALFRLTSYYMKQRRALSLLR 246
            |:.:.|.||::: .:||.......|..:|.:::..|.::.....|.:|:|:......:....::.
Mouse   191 IIMKCAFGQETNCQINGTYESYVKATFELGEIISSRLYNFWHHHDIIFKLSPKGHCFQELGKVIH 255

  Fly   247 SELNRIISQRRHQLAAENTCQQGQPINKPFLDVLLTAKL-DGKVLKEREIIEEVSTFIFTGHDPI 310
            ....:|| |.|.::......|.....::.|||::|:|:. |.:...:.::..||:||::.|||..
Mouse   256 QYTEKII-QDRKKILKNQVKQDDTQTSQIFLDIVLSAQAEDERAFSDADLRAEVNTFMWAGHDAS 319

  Fly   311 AAAISFTLYTLSRHSEIQQKAAEEQRRIFGENFAGEADLARLDQMHYLELIIRETLRLYPSVPLI 375
            ||:||:.||.|:.:.|.|.:...|.|.|.|:  .......:||:|.|..:.|:|||||.|.||.|
Mouse   320 AASISWLLYCLALNPEHQDRCRTEIRSILGD--GSSITWEQLDEMSYTTMCIKETLRLIPPVPSI 382

  Fly   376 ARTNRNPIDI-NGTKVAKCTTVIMCLIAMGYNEKYFDDPCTFRPERF--EN-----PTGNVGIEA 432
            :|....|:.: :|..:....||::.:..:.:|...::||..|.|.||  ||     |.      |
Mouse   383 SRELSKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWNDPKVFDPLRFTKENSDQRHPC------A 441

  Fly   433 FKSVPFSAGPRRCIAEKFAMYQMKALLSQLLRRFEILPAVDGLPPGINDHSREDCVPQSEYDPVL 497
            |  :|||:|||.||.::|||.::|..::.:|..|::.|.:. .||..:.|:              
Mouse   442 F--LPFSSGPRNCIGQQFAMLELKVAIALILLHFQVAPDLT-RPPAFSSHT-------------- 489

  Fly   498 NIRVTLKSENGIQIRLRK 515
                .|:.::||.:.|:|
Mouse   490 ----VLRPKHGIYLHLKK 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 131/459 (29%)
Cyp4x1NP_001003947.1 p450 47..499 CDD:278495 138/500 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167845097
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.