DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and CYP710A2

DIOPT Version :10

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_180996.1 Gene:CYP710A2 / 818012 AraportID:AT2G34490 Length:499 Species:Arabidopsis thaliana


Alignment Length:109 Identity:28/109 - (25%)
Similarity:46/109 - (42%) Gaps:26/109 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LFTNPFDVLKTRQQLEGELIAKQNLKERAYKGIRQSVLTVVRTDGLRGLQKGLPAALLYQF---- 75
            |..|..|.:..|:....|||...:| |..:|..:::.|:.::|.  ..|::.|      ||    
plant  1494 LTINGKDTVDERKVEAAELIMHWSL-EPNHKEAKENSLSPLKTS--ENLEESL------QFKENE 1549

  Fly    76 SMNGVRLGTYQTAENLGW-----------TKSTSN-PSLTPLLS 107
            |.:.|:|.....:.| .|           |:.|.| |:|.|.|:
plant  1550 SSHKVQLNITLQSRN-AWRRSQFFLQPVDTECTENSPALVPSLN 1592

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 CYP4 73..511 CDD:410721 14/51 (27%)
CYP710A2NP_180996.1 CYP61_CYP710 73..485 CDD:410703
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.