DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and cyp4f2

DIOPT Version :9

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001016020.1 Gene:cyp4f2 / 548774 XenbaseID:XB-GENE-6258041 Length:528 Species:Xenopus tropicalis


Alignment Length:442 Identity:126/442 - (28%)
Similarity:213/442 - (48%) Gaps:54/442 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 ILSSSSLLYKEHL-YSFLRPWLGDGLLTSSGARWLKHQKLYAPAFERSAIEGYLRVVHRTGGQFV 157
            :.:|:::..|:.| |.|||||||||||.|.|.:|.:|::|..|||....::.|:::       |.
 Frog   118 VAASAAIAPKDELFYGFLRPWLGDGLLLSRGEKWGQHRRLLTPAFHFDILKNYVKI-------FN 175

  Fly   158 QKLDVL--------SDTQEVFDAQELVAKCTLDIVCENATGQDSSSLNGETSDLHGAIKDLCDVV 214
            |..|::        ::.....|..|.|:..|||.:.:.....| |....:.||...||.:|..:|
 Frog   176 QSTDIMLAKWRRLTAEGPVSLDMFEHVSLMTLDTLLKCTFSYD-SDCQEKPSDYISAIYELSSLV 239

  Fly   215 QERTFSIVKRFDALFRLTSYYMKQRRALSLLRSELNRIISQRRHQL---AAENTCQQGQPINKPF 276
            .:|...:...||.::.|:|...|.|:|...:......::.||:..|   ..|...:..|...|.|
 Frog   240 VKREHYLPHHFDFIYNLSSNGRKFRQACKTVHEFTAGVVQQRKKALQEKGMEEWIKSKQGKTKDF 304

  Fly   277 LDVLLTAK-LDGKVLKEREIIEEVSTFIFTGHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIFG 340
            :|:||.:| .||..|.:.::..||.||:|.|||..|:.:|:.||.|:.|.|.|:|..:|...:..
 Frog   305 IDILLLSKNEDGSQLSDEDMRAEVDTFMFEGHDTTASGLSWILYNLACHPEYQEKCRKEITELLE 369

  Fly   341 ENFAGEADLARLDQMHYLELIIRETLRLYPSVPLIARTNRNPIDI---NGTKVAKCTTVIMCLIA 402
            .......:...|.::.:..:.|:|:|||:|  |::|...|...||   .|..:.|....|:.:..
 Frog   370 GKDIKHLEWDELSKLPFTTMCIKESLRLHP--PVVAVIRRCTEDIKLPKGDILPKGNCCIINIFG 432

  Fly   403 MGYNEKYFDDPCTFRPERFENPTGNVGIEAFKSVPFSAGPRRCIAEKFAMYQMKALLSQLLRRFE 467
            :.:|...:.:|..:.|.||: |.......::..||||||||.||.:.|||.:||.:|:.:|..|:
 Frog   433 IHHNPDVWPNPQVYDPYRFD-PENLQERSSYAFVPFSAGPRNCIGQNFAMAEMKIVLALILYNFQ 496

  Fly   468 ILPAVDGLPPGINDHSREDCVPQSEYDPVLNIR----VTLKSENGIQIRLRK 515
            :                       ..|....:|    :.|::|||:.:::.:
 Frog   497 V-----------------------RLDETKTVRRKPELILRAENGLWLQVEE 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 120/391 (31%)
cyp4f2NP_001016020.1 p450 60..513 CDD:278495 122/428 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.