DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and Cyp6a17

DIOPT Version :9

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001286433.1 Gene:Cyp6a17 / 45556 FlyBaseID:FBgn0015714 Length:501 Species:Drosophila melanogaster


Alignment Length:560 Identity:127/560 - (22%)
Similarity:226/560 - (40%) Gaps:107/560 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLIAIAIILATILVFKGVRIFNYIDHMAGIMEMIPGPTPYPFVGNL---------------FQF 50
            |.|:|:.:::.::|||...|...|.....     ||....:|..||:               :.|
  Fly     1 MLLLALIVVILSLLVFAARRRHGYWQRRG-----IPHDEVHPLFGNIKDWPNKRHIAEIFRDYYF 60

  Fly    51 GLKPAEYPKKVLQYCRKYDFQGFRSLVFLQYHMMLSDPAEIQNILSSSSLLYKEH--LYSFLRPW 113
            ..|.::||           |.||  ..|.....:::|...::.:|......::..  .|:.:...
  Fly    61 KYKNSDYP-----------FAGF--FFFFTRTAVVTDMELLKRVLIKDFNHFENRGVFYNEIDDP 112

  Fly   114 LGDGLLTSSGARW--LKHQKLYAPAFERSAIEGYLRVVHRTGGQF--VQKLDVLSDTQEVFDAQE 174
            |...|.:..|.:|  |:|:  ..|.|....::....:|.:.|.:.  |.:....:|..:|.:..:
  Fly   113 LSATLFSIEGQKWRHLRHK--LTPTFTSGKMKNMFPIVVKVGEEMDKVFRSKTAADRGQVLEVVD 175

  Fly   175 LVAKCTLDIVCENATGQDSSSLNGETSDLHGAIKDLCDVVQERTFSIVKRFDALFRLTSYYMKQR 239
            |||:.|.|::...|.|.:.:||....::.....|..  :.:.|..:::..|  ||.......:.|
  Fly   176 LVARYTADVIGNCAFGLNCNSLYDPKAEFVSIGKRA--ITEHRYGNMLDIF--LFGFPKLSRRLR 236

  Fly   240 RALSLLRSE------LNRIISQRRHQLAAENTCQQGQPINKPFLDVLLTA--------KLDGKVL 290
            ..|::..:|      :...|..|.......|          .|:|.|:..        ..||  |
  Fly   237 LKLNIQEAEDFYTKIVRETIDYRLRTKEKRN----------DFMDSLIEMYKNEQSGNSEDG--L 289

  Fly   291 KEREIIEEVSTFIFTGHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIFGEN---FAGEADLARL 352
            ...|::.:...|...|.:..:..:.|.||.|:|:.::|.|..||...:||::   |..|.    :
  Fly   290 TFNELLAQAFIFFVAGFETSSTTMGFALYELARNQDVQDKLREEIGNVFGKHNKEFTYEG----I 350

  Fly   353 DQMHYLELIIRETLRLYPSVPLIARTNRNPIDINGTK--VAKCTTVIMCLIAMGYNEKYFDDPCT 415
            .:|.|||.::.||||.||.:..:.|...........|  :||.|.|::..:.:.|:...:.:|..
  Fly   351 KEMKYLEQVVMETLRKYPVLAHLTRMTDTDFSPEDPKYFIAKGTIVVIPALGIHYDPDIYPEPEI 415

  Fly   416 FRPERFENPTGNVGIEAFKS---VPFSAGPRRCIAEKFAMYQMKALLSQLLR--RFEILPAVDGL 475
            |:||||.:..    |.|..|   :||..|||.||..:|.|.|....|:.|:|  :|.:.|     
  Fly   416 FKPERFTDEE----IAARPSCTWLPFGEGPRNCIGLRFGMMQTCVGLAYLIRGYKFSVSP----- 471

  Fly   476 PPGINDHSREDCVPQSEYDPVLNIRVTLKSENGIQIRLRK 515
                     |..:|..    ::...:.:.:||||.:::.|
  Fly   472 ---------ETQIPMK----IVVKNILISAENGIHLKVEK 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 110/478 (23%)
Cyp6a17NP_001286433.1 p450 36..478 CDD:278495 112/494 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.