DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and Cyp6a18

DIOPT Version :9

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_001287562.1 Gene:Cyp6a18 / 43304 FlyBaseID:FBgn0039519 Length:507 Species:Drosophila melanogaster


Alignment Length:550 Identity:127/550 - (23%)
Similarity:221/550 - (40%) Gaps:89/550 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FLIAIAIILATILVFKGVRIFNYIDHMAGIMEMIPGPTPYPFVGNLFQFGLKPAEYPKKVLQ-YC 65
            ||..:|:.|..|:.:...|...|.....     ||...|:|..||:  .|.|......::.| |.
  Fly     6 FLFQVAVALLAIVTYILHRKLTYFKRRG-----IPYDKPHPLRGNM--EGYKKTRTVHEIHQEYY 63

  Fly    66 RKY-----DFQGF----RSLVFLQYHMMLSDPAEIQNI--LSSSSLLYKE-------HLYSFLRP 112
            .||     .|.||    :...|: ..:.|:....|:|.  .:...:.|.|       ||::.   
  Fly    64 NKYRNSKAPFVGFYLFQKPAAFV-IDLELAKQILIKNFSNFTDKGIYYNEKDDPMSAHLFNL--- 124

  Fly   113 WLGDGLLTSSGARWLKHQKLYAPAFERSAIEGYLRVVHRTGGQFVQKLDVLSDTQEVFDAQELVA 177
                     .|.:|...:...:..|....::.....|.....:|:..:........:.|.::|||
  Fly   125 ---------DGPQWRLLRSKLSSTFTSGKMKFMYPTVVSVAEEFMAVMHEKVSENSILDVRDLVA 180

  Fly   178 KCTLDIVCENATGQDSSSLNGETSD-LHGAIKDLCDVVQERTFSIVKRFDALFRLTSYYMKQRRA 241
            :.|:|::...|.|...:||..|.:: ||...:.|.|   .|..::|.      .|...|....|.
  Fly   181 RFTVDVIGTCAFGIKCNSLRDEKAEFLHFGRRALLD---SRHGNLVS------GLMRSYPNLARR 236

  Fly   242 LSLLRSELNRIISQRRHQLAAEN-TCQQGQPINK-PFLDVLLTAK-------LDGKVLK---ERE 294
            |.|.|:...  |.:...::..|. |.::.:.|.: .|:|:|:..|       .:|:|:|   ..|
  Fly   237 LGLCRNTAQ--IQEFYQRIVKETVTLREKENIKRNDFMDMLIGLKNQKNMTLENGEVVKGLTMDE 299

  Fly   295 IIEEVSTFIFTGHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIF---GENFAGEADLARLDQMH 356
            |:.:...|...|.|..::.:.|.||.|:::..||.|...|..::.   .:.|..|.    :..:.
  Fly   300 IVAQAFVFFIAGFDTSSSTMGFALYELAKNPSIQDKVRAELGQVLEQHDQKFTYEC----IKDLK 360

  Fly   357 YLELIIRETLRLYPSVPLIARTNRNPIDINGTK---VAKCTTVIMCLIAMGYNEKYFDDPCTFRP 418
            ||:.:|.||||.|..||.:.|.......:.|..   :....:||:...|:.::...:.:|..|||
  Fly   361 YLDQVINETLRHYTIVPNVDRVAAKRFVVPGNPKFVIEAGQSVIIPSSAIHHDPSIYPEPNEFRP 425

  Fly   419 ERFENPTGNVGIEAFKSVPFSAGPRRCIAEKFAMYQMKALLSQLLRRFEILPAVDGLPPGINDHS 483
            ||| :|..:....:...:||..|||.||..:|...|.:..|:.|::.|...|. ...|..:.   
  Fly   426 ERF-SPEESAKRPSVAWLPFGEGPRNCIGLRFGQMQARIGLAMLIKNFTFSPC-SATPDPLT--- 485

  Fly   484 REDCVPQSEYDPVLNIRVTLKSENGIQIRL 513
                     :||  :..:.|..:.|||:::
  Fly   486 ---------FDP--HSAILLGIKGGIQLKV 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 111/471 (24%)
Cyp6a18NP_001287562.1 p450 38..504 CDD:278495 118/511 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.