DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and Cyp313a3

DIOPT Version :9

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_650170.2 Gene:Cyp313a3 / 41488 FlyBaseID:FBgn0038007 Length:492 Species:Drosophila melanogaster


Alignment Length:524 Identity:117/524 - (22%)
Similarity:218/524 - (41%) Gaps:81/524 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIAIAIILATILVFKGVRIFNYIDHMAGIMEMIPGPTPYPFVGNLFQFGLKPAEYPKKVLQYCRK 67
            |:|:.:......::...|:  |:.|.     .||||...|.:|..|::.:   .|.:|:....:.
  Fly     7 LLAVGVCFWIYFLWSRRRL--YMMHF-----KIPGPMGLPILGIAFEYLI---TYKRKMSIRTKY 61

  Fly    68 YDFQGFRSLVFL--QYHMMLSDPAEIQNILSSSSLLYKEHLYSFLRP---WLGDGLLTSSGARWL 127
            .|..|...||::  ...::..||...:.|..|...|.:..::|  :|   ..|||||:...::|:
  Fly    62 MDIYGSTCLVWVGPTPFVITRDPKIAEEIFLSPECLNRSSIFS--KPVNSCTGDGLLSLEASKWV 124

  Fly   128 KHQKLYAPAFERSAIEGYLRVVHRTGGQFVQKLDVLSDTQEVFDAQELVAKCTLDIVCENATGQD 192
            ..:|...|||:::.:..:|.:.:......|..||.|....|. ..::.:.:.:..|..:...|  
  Fly   125 DRRKNLNPAFKQNVLLSFLPIFNSEAKTLVAFLDSLVGQGEK-KVRDDIVRWSFRIATQTTVG-- 186

  Fly   193 SSSLNGETSDLHGAIKDLCDVVQERTF---SIVKRFDALFRL----------------TSYYMKQ 238
                              .||.::.:|   |::|.::...::                |....:.
  Fly   187 ------------------TDVKKDASFKNDSVLKSYETFMKIIVMNVLLPFTHNKIFSTLGGFET 233

  Fly   239 RRALSLLRSELNRIISQRRHQLAAENTCQQGQPINKPFLDVLLTAKLDGKVLKEREIIEEVSTFI 303
            ::||:  :|.:|::|.....:..........||.....::..:....:|::.:| |:..|..:|:
  Fly   234 QKALA--KSNVNKMIGTIVDKKLMTKPESGSQPEITSVINKAIELHRNGEMSRE-EVQSECCSFV 295

  Fly   304 FTGHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIFGENFAGEADLA--RLDQMHYLELIIRETL 366
            ....:.....:...|..|:...|.|....:|.:.:|  ..||:.::.  .|.:|.:||.::.|||
  Fly   296 VAAFETTGDTVYHALILLAMFPEHQDTVYQELKELF--PVAGDFEVTYDDLQRMVFLERVVNETL 358

  Fly   367 RLYPSVPLIAR-TNRNPIDINGTKVAKCTTVIMCLIAMGYNEKYF-DDPCTFRPERFENPTGNVG 429
            ||.||||...| |.|:....:|..:.|...:.:.:.|...|..:: .||.:|.|:.| .|.....
  Fly   359 RLIPSVPFTPRETIRDFRLSSGVVIPKGVGIGIDIFATHRNRDHWGTDPSSFNPDHF-LPDNVRD 422

  Fly   430 IEAFKSVPFSAGPRRCIAEKFAMYQMKALLSQLLR--------RFEILPAVDGL------PPGIN 480
            ...:..:|||.|.|.||..|:.:...|..||::||        |:|.|..||.:      .||:.
  Fly   423 RHPYAYIPFSKGRRNCIGWKYGLMSSKLALSKILRNCKVSTSFRYEDLEFVDNIGMELAQSPGLE 487

  Fly   481 DHSR 484
            .|.|
  Fly   488 FHRR 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 104/469 (22%)
Cyp313a3NP_650170.2 p450 33..463 CDD:299894 102/461 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.