DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and Cyp313a2

DIOPT Version :9

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_650169.3 Gene:Cyp313a2 / 41487 FlyBaseID:FBgn0038006 Length:493 Species:Drosophila melanogaster


Alignment Length:511 Identity:105/511 - (20%)
Similarity:197/511 - (38%) Gaps:95/511 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIAIAIILATILVFKGVRIFNYIDHMAGIMEMIPGPTPYPFVGNLFQFGLKPAEYPKKVLQYCRK 67
            :|.|.:::|..|:. .:|.......:..:|..:||....|.:||..::.:...........|..|
  Fly     1 MIVIQLLIAASLIL-WIRFLWSRRKLYMLMMQLPGRMGLPLLGNSVRYLIISRGRMSSRTTYMDK 64

  Fly    68 YD-----FQGFRSLVFLQYHMMLSDPAEIQNILSSSSLLYK-EHLYSFLRPWLGDGLLTSSGARW 126
            :.     :.|...:|..:      ||...:.:|:|...:.: ....:.|...:|.||||..|::|
  Fly    65 HGSTYMAWIGTTPIVITR------DPKIAEKVLTSPFCINRSSQTTNALALSMGYGLLTLQGSKW 123

  Fly   127 LKHQKLYAPAFERSAIEGYLRVVHRTGGQFVQ---------KLDVLSDTQEVFDAQELVAKCTLD 182
            :..:|...|||:.|.:..:|.:.:......|.         :.|||||          :.:.:..
  Fly   124 MARRKHMNPAFKHSVLLSFLPIFNAETDLLVSVFDSFVGQGEKDVLSD----------LIRWSFA 178

  Fly   183 IVCENATGQDSSSLNGETSDLHGAIKDLCDVVQERTFSIVKRFDALFRLT--------------- 232
            |..:...|.|.:..:...:|                 :|:|.:.::.|||               
  Fly   179 IATQTTLGTDVTKDDNFEND-----------------AILKTYQSMLRLTIINIFVPFVQNKIVS 226

  Fly   233 ---SYYMKQRRALSLLRSELNRIISQRRHQLAAENTCQQGQPINKPFLDVLLTAKLDGKVLKERE 294
               .....:||..|.:...:|.|:.::.:. ..||.|:..       |..::...::.....|..
  Fly   227 KLFGLEWLRRRDASAINKMINNILDKKLNS-NPENYCESE-------LKTVIHRAIELFRNDEMS 283

  Fly   295 IIE---EVSTFIFTGHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIFGENFAGEADLARLDQMH 356
            ::|   |.|:.:....:..|..:.:.|..|:...|.|:....|.:..|......|.....|.|:.
  Fly   284 LMELGAECSSMVLAAFETSAHTVYYALVLLAMFPEHQEMVFNEIKEHFPLAKGIEVTHTDLQQLV 348

  Fly   357 YLELIIRETLRLYPSVPLIARTNRNPIDI-NGTKVAKCTTVIMCLIAMGYNEKYF-DDPCTFRPE 419
            ||:.::.|||||.||||..:|.....:.: ||..:.|..|:.:.:.....|..|: .:...|.||
  Fly   349 YLDRVLNETLRLMPSVPFSSRETLEDLRLSNGVVIPKGMTISIDIFNTQRNTDYWGSEAAQFNPE 413

  Fly   420 RF-------ENPTGNVGIEAFKSVPFSAGPRRCIAEKFAMYQMKALLSQLLRRFEI 468
            .|       .:|        :..:|||.|.|.||..::.:...|..|.::||.:::
  Fly   414 NFLPEKIHDRHP--------YAFIPFSKGKRNCIGWRYGLMSSKLALVKILRNYKL 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 99/478 (21%)
Cyp313a2NP_650169.3 p450 33..463 CDD:299894 99/478 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.