DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and Cyp313a5

DIOPT Version :9

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_650168.1 Gene:Cyp313a5 / 41486 FlyBaseID:FBgn0038005 Length:487 Species:Drosophila melanogaster


Alignment Length:494 Identity:114/494 - (23%)
Similarity:213/494 - (43%) Gaps:80/494 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AIAIILATILVFKGVRIFNYIDHMAGIMEMIPGPTPYPFVGNLFQFGLKPAEYPKKVLQYCRKYD 69
            |.||||....::...|.  ||     :|..:|||..:||:|..|::           ::..||. 
  Fly     9 AFAIILCVYFLWSRRRF--YI-----MMLKLPGPMGFPFIGLAFEY-----------IRLKRKI- 54

  Fly    70 FQGFRSLVFLQYH------------MMLSDPAEIQNILSS------SSLLYKEHLYSFLRPWLGD 116
              ..|:::|..|.            ::..:|..:::|.:|      ||::.|.     :...||.
  Fly    55 --RLRTILFKIYGKTVLTWIGLTPVLVTCEPKILEDIFTSPNCSNRSSVVDKA-----ISSCLGL 112

  Fly   117 GLLTSSGARWLKHQKLYAPAFERSAIEGYLRVVHRTGGQFVQKLDVLSDTQEVFDAQELVAKCTL 181
            ||||.....|.:.:||..|:|:.:|:..::.|::......|..|....|..::....|| .|.:.
  Fly   113 GLLTLKNNHWNERRKLLLPSFKNNAVLSFVPVLNNEANFLVTLLAEFVDGGDINLLPEL-NKWSF 176

  Fly   182 DIVCENATGQD----SSSLNGETSDLHGAIKDLCDVVQERTFSIVK---RFDALFRLTSYYMKQR 239
            .|..:...|.:    ::..||...:.:.|:.:|..:      .:|.   |...|.:|.||..::.
  Fly   177 KIAAQITMGDEVRNQANYQNGNLLESYKALNNLIPI------GVVMPWLRNKYLGKLFSYEKRRL 235

  Fly   240 RALSLLRSELNRIISQRRHQLAAENTCQQGQPINKPFLDVLLTAKLDGKVLKEREIIEEVSTFIF 304
            .|.:...:.:..||.::     ..:|....:|   ..:|.:|.....|: |...:::.|.|..||
  Fly   236 EAATQSNAFIKDIIDKK-----LSSTDNSSEP---ALIDRILNLVRIGE-LSYDDVMGEFSNIIF 291

  Fly   305 TGHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIF---GENFAGEADLARLDQMHYLELIIRETL 366
            ...|.::..::..|..::...:.|....||...:|   ||..|..|||.:|.:   |:.::.||:
  Fly   292 AASDTLSITVNNVLILMAMFPKYQDNVFEELAEVFPSGGEFEASHADLEKLVK---LDRVLHETM 353

  Fly   367 RLYPSVPLIARTNRNPIDI-NGTKVAKCTTVIMCLIAMGYNEKYFDDPC-TFRPERF--ENPTGN 427
            ||.|:|||:.|...:.|.: ||..:.:..|:::.:.....|:..:.... .|.|:.|  ||....
  Fly   354 RLIPAVPLLIRQTSHSIQLSNGFYIPEGVTLMIDIFHTHRNKDIWGPQANAFNPDNFLPENKRAR 418

  Fly   428 VGIEAFKSVPFSAGPRRCIAEKFAMYQMKALLSQLLRRF 466
               ..:..:|||.|.:.|:..|.::...|..|:::||.:
  Fly   419 ---PPYSYLPFSKGKKTCLGWKLSLISAKLALAKILRNY 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 105/463 (23%)
Cyp313a5NP_650168.1 p450 33..458 CDD:299894 105/463 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.