DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and CYP4F3

DIOPT Version :9

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens


Alignment Length:438 Identity:135/438 - (30%)
Similarity:229/438 - (52%) Gaps:37/438 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 PAEIQNIL-SSSSLLYKEHL-YSFLRPWLGDGLLTSSGARWLKHQKLYAPAFERSAIEGYLRVVH 150
            |..|:.:| :.::::.|:.: ||||:||||||||.|:|.:|.:|:::..|||..:.::.|:::.:
Human   104 PTYIKPVLFAPAAIVPKDKVFYSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFN 168

  Fly   151 RTGGQFVQKLDVL-SDTQEVFDAQELVAKCTLDIVCENATGQDSSSLNGETSDLHGAIKDLCDVV 214
            .:......|..:| |:.....|..|.::..|||.: :.......|....:.|:...||.:|..:|
Human   169 ESVNIMHAKWQLLASEGSARLDMFEHISLMTLDSL-QKCVFSFDSHCQEKPSEYIAAILELSALV 232

  Fly   215 QERTFSIVKRFDALFRLTSYYMKQRRALSLLRSELNRIISQRRHQLAAENTCQ--QGQPINK--P 275
            .:|...|:...|.|:.||....:.|||..|:....:.:|.:||..|.::....  |.:..:|  .
Human   233 TKRHQQILLYIDFLYYLTPDGQRFRRACRLVHDFTDAVIQERRRTLPSQGVDDFLQAKAKSKTLD 297

  Fly   276 FLDVLLTAK-LDGKVLKEREIIEEVSTFIFTGHDPIAAAISFTLYTLSRHSEIQQKAAEEQRRIF 339
            |:||||.:| .|||.|.:.:|..|..||:|.|||..|:.:|:.||.|::|.|.|::..:|.:.:.
Human   298 FIDVLLLSKDEDGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELL 362

  Fly   340 GENFAGEADLARLDQMHYLELIIRETLRLYPSVPLIARTNRNPIDI-NGTKVAKCTTVIMCLIAM 403
            .:....|.:...|.|:.:|.:.|:|:|||:|.||.::|.....|.: :|..:.|   .|:|||::
Human   363 KDREPKEIEWDDLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPK---GIICLISV 424

  Fly   404 ---GYNEKYFDDPCTFRPERFENPTGNVGIEAFKSVPFSAGPRRCIAEKFAMYQMKALLSQLLRR 465
               .:|...:.||..:.|.||: |...........:|||||||.||.:.|||.:||.:|...|.|
Human   425 FGTHHNPAVWPDPEVYDPFRFD-PKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLR 488

  Fly   466 FEILPAVDGLPPGINDHSREDCVPQSEYDPVLNIRVTLKSENGIQIRL 513
            |.:||          ||:          :|.....:.|::|.|:.:|:
Human   489 FRVLP----------DHT----------EPRRKPELVLRAEGGLWLRV 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 126/393 (32%)
CYP4F3NP_000887.2 p450 52..515 CDD:365848 134/435 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154788
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.650

Return to query results.
Submit another query.