DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and Cyp9c1

DIOPT Version :9

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_523850.1 Gene:Cyp9c1 / 37941 FlyBaseID:FBgn0015040 Length:522 Species:Drosophila melanogaster


Alignment Length:530 Identity:117/530 - (22%)
Similarity:209/530 - (39%) Gaps:101/530 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFLIAIAIILATI--LVFK-GVRIFNYIDHMAGIMEMIPGPTPYPFVGNLFQFGLKPAEYPKKVL 62
            |..:.::|.:|.|  |::| .|..|.|.....     :....|.|.:||:          |..||
  Fly     1 MVFVELSIFVAFIGLLLYKWSVYTFGYFSKRG-----VAHEKPIPLLGNI----------PWSVL 50

  Fly    63 QYCRKYDFQGFRSLVFLQYHMM------------LSDPAEIQNILSSSSLLYKEHLYSFLRPWLG 115
            .....|........:.|:.|.:            ||||..|:.:...:...:..|     |..:.
  Fly    51 MGKESYIKHSIDLHLRLKQHKVYGVFNLRDPLYYLSDPELIRQVGIKNFDTFTNH-----RKGIT 110

  Fly   116 DG----------LLTSSGARWLKHQKLYAPAFERSAIEGYLRVVHRTGGQ---FVQK-LDVLSDT 166
            :|          ||:....||.:.:....|.|....|.....::|....:   |||: ||  :.|
  Fly   111 EGFNDTSVISKSLLSLRDRRWKQMRSTLTPTFTSLKIRQMFELIHFCNVEAVDFVQRQLD--AGT 173

  Fly   167 QEVFDAQELVAKCTLDIVCENATGQDSSSLNGETSDLH------------GAIKDLCDVVQERTF 219
            .|: :.::...:.|.|::...|.|...:|.....::..            |.:|.:..::..:..
  Fly   174 SEL-ELKDFFTRYTNDVIATAAFGIQVNSFKDPNNEFFSIGQRISEFTFWGGLKVMLYILMPKLM 237

  Fly   220 SIVK-------RFDALFRLTSYYMKQRRALSLLRSELNRIISQRRHQLAAENTCQQGQPINKPFL 277
            ..::       ..|...:|....||.|:..|::|.::..::.:.:.|..||   |:|...:    
  Fly   238 KALRVPVMDMNNVDYFKKLVFGAMKYRKEQSIVRPDMIHLLMEAQRQFKAE---QEGSAES---- 295

  Fly   278 DVLLTAKLDGKVLKEREIIEEVSTFIFTGHDPIAAAISFTLYTLSRHSEIQQK------AAEEQR 336
                .|:.|.....:.:::.:...|...|.:.:|..:|||.|.|..:.|:|:|      |.:|| 
  Fly   296 ----AAQQDKAEFNDDDLLAQCLLFFSAGFETVATCLSFTSYELMMNPEVQEKLLAEILAVKEQ- 355

  Fly   337 RIFGENFAGEADLARLDQMHYLELIIRETLRLYPSVPLIARTNRNPI---DINGTKVAKCTTVIM 398
              .||.   ..|...|..|.||..::.|:||.:|...::.|...:..   |..|..|.......:
  Fly   356 --LGEK---PLDYDTLMGMKYLNCVVSESLRKWPPAFIVDRMCGSDFQLKDEEGEVVVNLREDDL 415

  Fly   399 CLIAMG---YNEKYFDDPCTFRPERFENPTGNVGIEAFKSVPFSAGPRRCIAEKFAMYQMKALLS 460
            ..|.:|   ::...|.:|..||||||:....: .|..|..:||..|.|.||..:.|:.::|:|:.
  Fly   416 VHINVGALHHDPDNFPEPEQFRPERFDEEHKH-EIRQFTYLPFGVGQRSCIGNRLALMEVKSLIF 479

  Fly   461 QLLRRFEILP 470
            ||:.|:.:.|
  Fly   480 QLVLRYHLKP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 107/490 (22%)
Cyp9c1NP_523850.1 p450 37..514 CDD:299894 108/489 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.