DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4ad1 and Cyp6a9

DIOPT Version :9

Sequence 1:NP_610380.1 Gene:Cyp4ad1 / 35821 FlyBaseID:FBgn0033292 Length:516 Species:Drosophila melanogaster
Sequence 2:NP_523748.2 Gene:Cyp6a9 / 36663 FlyBaseID:FBgn0013771 Length:504 Species:Drosophila melanogaster


Alignment Length:574 Identity:122/574 - (21%)
Similarity:228/574 - (39%) Gaps:138/574 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LIAIAIILATILVFKGVRIFNYIDHMAGIMEMIPGPTPYPFVGNLFQFGLKPAEYPKKV-LQYCR 66
            |:||.::|...|:.|..|..:|..::.     ||...|:..:|:|  .|::.:.....: :.|..
  Fly     7 LLAIVVVLVGYLLLKWRRALHYWQNLD-----IPCEEPHILMGSL--TGVQTSRSFSAIWMDYYN 64

  Fly    67 KY----DFQGF---------------RSLVFLQ----------YHMMLSDPAEIQNILSSSSLLY 102
            |:    .|.||               ..|:.::          ||....||              
  Fly    65 KFRGTGPFAGFYWFQRPGILVLDISLAKLILIKEFNKFTDRGFYHNTEDDP-------------- 115

  Fly   103 KEHLYSFLRPWLGDGLLTSSGARWLKHQKLYAPAFERSAIEGYLRVVHRTGGQFVQKLDVLSDTQ 167
                       |...|....|.:|...:...:..|....::.....|.:.|.:|::......:..
  Fly   116 -----------LSGQLFLLDGQKWKSMRSKLSYTFTSGKMKYMFPTVVKVGHEFIEVFGQAMEKS 169

  Fly   168 EVFDAQELVAKCTLDIVCENATGQDSSSLNGETSDL------------HGAIKDLCDVVQERTFS 220
            .:.:.::::|:.|.|::...|.|.:.|||....::.            ||.|          ..:
  Fly   170 PIVEVRDILARFTTDVIGTCAFGIECSSLKDPEAEFRVMGRRAIFEQRHGPI----------GIA 224

  Fly   221 IVKRFDALFRLTSYYMKQRRALSLLRSE--LNRIISQRRHQLA--AENTCQQGQPINKPFLDVLL 281
            .:..|..|.|  ..:||    ::|..:|  ..||:   |..:|  .:|..::..     |:|.|:
  Fly   225 FINSFQNLAR--RLHMK----ITLEEAEHFFLRIV---RETVAFREKNNIRRND-----FMDQLI 275

  Fly   282 TAKLDGKVLKERE------IIEEVS--TFIF--TGHDPIAAAISFTLYTLSRHSEIQQKAAEEQR 336
            ..| :..:.|...      .|||::  .|:|  .|.:..:..:.|.||.|::|.:||.:..:|.:
  Fly   276 DLK-NSPLTKSESGESVNLTIEEMAAQAFVFFGAGFETSSTTMGFALYELAQHQDIQDRVRKECQ 339

  Fly   337 RIFGENFAGEADLARLDQMHYLELIIRETLRLYPSVPLIARTNRNPIDINGTK---VAKCTTVIM 398
            .:.|: :.||.....:..|.||:.:|.||||||..:|::.|......::.|..   :.|...|::
  Fly   340 EVIGK-YNGEITYESMKDMVYLDQVISETLRLYTVLPVLNRECLEDYEVPGHPKYVIKKGMPVLI 403

  Fly   399 CLIAMGYNEKYFDDPCTFRPERFENPTGNVGIEAFKSVPFSAGPRRCIAEKFAMYQMKALLSQLL 463
            ...||..:||.:.:|.||.|:.| :|......::.:.:||..|||.||..:|...|.::.|:.|:
  Fly   404 PCGAMHRDEKLYANPNTFNPDNF-SPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARSGLALLI 467

  Fly   464 RRFEILPAVDGLPPGINDHSREDCVPQSEYDPVLNIRVT--LKSENGIQIRLRK 515
            .||:.                  .|.:....|::..:.|  :.||.||.:::.:
  Fly   468 NRFKF------------------SVCEQTTIPIVYSKKTFLISSETGIFLKVER 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4ad1NP_610380.1 p450 36..470 CDD:278495 106/492 (22%)
Cyp6a9NP_523748.2 p450 35..499 CDD:278495 113/535 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100014
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.